| UniProt ID | H2A1_XENLA | |
|---|---|---|
| UniProt AC | P06897 | |
| Protein Name | Histone H2A type 1 | |
| Gene Name | ||
| Organism | Xenopus laevis (African clawed frog). | |
| Sequence Length | 130 | |
| Subcellular Localization | Nucleus. Chromosome. | |
| Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
| Protein Sequence | MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGRGKQGG ------CCCCCCCCC | 36.88 | - | |
| 2 | Acetylation | ------MSGRGKQGG ------CCCCCCCCC | 36.88 | - | |
| 6 | Acetylation | --MSGRGKQGGKTRA --CCCCCCCCCCCCC | 44.39 | - | |
| 6 | Other | --MSGRGKQGGKTRA --CCCCCCCCCCCCC | 44.39 | - | |
| 10 | Other | GRGKQGGKTRAKAKT CCCCCCCCCCCCHHH | 41.48 | - | |
| 10 | Lactoylation | GRGKQGGKTRAKAKT CCCCCCCCCCCCHHH | 41.48 | - | |
| 10 | Succinylation | GRGKQGGKTRAKAKT CCCCCCCCCCCCHHH | 41.48 | - | |
| 37 | Other | RVHRLLRKGNYAERV HHHHHHHCCCHHHHC | 52.02 | - | |
| 75 | Other | GNAARDNKKTRIIPR CHHHHCCCCCCEEHH | 60.87 | - | |
| 76 | Other | NAARDNKKTRIIPRH HHHHCCCCCCEEHHH | 49.65 | - | |
| 96 | Glutarylation | RNDEELNKLLGGVTI CCHHHHHHHHCCEEE | 58.68 | - | |
| 96 | Other | RNDEELNKLLGGVTI CCHHHHHHHHCCEEE | 58.68 | - | |
| 96 | Succinylation | RNDEELNKLLGGVTI CCHHHHHHHHCCEEE | 58.68 | - | |
| 105 | Methylation | LGGVTIAQGGVLPNI HCCEEEECCCCCCCH | 45.37 | - | |
| 119 | Other | IQSVLLPKKTESAKS HHHEECCCCCHHHHH | 72.76 | - | |
| 119 | Glutarylation | IQSVLLPKKTESAKS HHHEECCCCCHHHHH | 72.76 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H2A1_XENLA !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H2A1_XENLA !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2A1_XENLA !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of H2A1_XENLA !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
