dbPTM

H12_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	H12_ARATH
UniProt AC	P26569
Protein Name	Histone H1.2
Gene Name	At2g30620
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	273
Subcellular Localization	Nucleus. Chromosome.
Protein Description	Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures..
Protein Sequence	MSIEEENVPTTVDSGAADTTVKSPEKKPAAKGGKSKKTTTAKATKKPVKAAAPTKKKTTSSHPTYEEMIKDAIVTLKERTGSSQYAIQKFIEEKHKSLPPTFRKLLLVNLKRLVASEKLVKVKASFKIPSARSAATPKPAAPVKKKATVVAKPKGKVAAAVAPAKAKAAAKGTKKPAAKVVAKAKVTAKPKAKVTAAKPKSKSVAAVSKTKAVAAKPKAKERPAKASRTSTRTSPGKKVAAPAKKVAVTKKAPAKSVKVKSPAKRASTRKAKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSIEEENVP ------CCCCCCCCC	38.41	22223895
2	Phosphorylation	------MSIEEENVP ------CCCCCCCCC	38.41	30291188
10	Phosphorylation	IEEENVPTTVDSGAA CCCCCCCCCCCCCCC	34.86	30407730
11	Phosphorylation	EEENVPTTVDSGAAD CCCCCCCCCCCCCCC	19.08	30407730
14	Phosphorylation	NVPTTVDSGAADTTV CCCCCCCCCCCCCCC	26.45	30291188
19	Phosphorylation	VDSGAADTTVKSPEK CCCCCCCCCCCCCCC	28.85	30407730
20	Phosphorylation	DSGAADTTVKSPEKK CCCCCCCCCCCCCCC	26.87	30407730
23	Phosphorylation	AADTTVKSPEKKPAA CCCCCCCCCCCCCCC	33.67	30291188
136	Phosphorylation	PSARSAATPKPAAPV CCCCCCCCCCCCCCC	31.40	25561503
148	Phosphorylation	APVKKKATVVAKPKG CCCCCEEEEEECCCC	25.13	25561503
156	Ubiquitination	VVAKPKGKVAAAVAP EEECCCCCEEEEEHH	34.52	19292762
165	Ubiquitination	AAAVAPAKAKAAAKG EEEEHHHHHHHHHCC	49.73	19292762
187	Phosphorylation	VVAKAKVTAKPKAKV HHHCCCCCCCCCCEE	28.40	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of H12_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of H12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of H12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
DME_ARATH	DME	physical	22519754

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of H12_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2; SER-14 AND SER-23,AND MASS SPECTROMETRY.	19376835 [Abstract]
Ubiquitylation
Reference	PubMed
"Tandem affinity purification and mass spectrometric analysis ofubiquitylated proteins in Arabidopsis."; Saracco S.A., Hansson M., Scalf M., Walker J.M., Smith L.M.,Vierstra R.D.; Plant J. 59:344-358(2009). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-156 AND LYS-165, ANDIDENTIFICATION BY MASS SPECTROMETRY.	19292762 [Abstract]