| UniProt ID | H11_RAT | |
|---|---|---|
| UniProt AC | D4A3K5 | |
| Protein Name | Histone H1.1 | |
| Gene Name | Hist1h1a | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 214 | |
| Subcellular Localization | Nucleus . Chromosome . Mainly localizes in euchromatin.. | |
| Protein Description | H1 histones bind to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. H1 histones are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling (By similarity).. | |
| Protein Sequence | MSETAPVPQPASVAPEKPAATKKTRKPAKAAVPRKKPAGPSVSELIVQAVSSSKERSGVSLAALKKSLAAAGYDVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLNKKAESKASTTKVTVKAKASGAAKKPKKTAGAAAKKTVKTPKKPKKPAVSKKTSSKSPKKPKVVKAKKVAKSPAKAKAVKPKAAKVKVTKPKTPAKPKKAAPKKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSETAPVPQ ------CCCCCCCCC | - | ||
| 2 | Phosphorylation | ------MSETAPVPQ ------CCCCCCCCC | 27097102 | ||
| 4 | Phosphorylation | ----MSETAPVPQPA ----CCCCCCCCCCC | 27097102 | ||
| 12 | Phosphorylation | APVPQPASVAPEKPA CCCCCCCCCCCCCCC | 27097102 | ||
| 17 | Acetylation | PASVAPEKPAATKKT CCCCCCCCCCCCCCC | 22902405 | ||
| 22 | Acetylation | PEKPAATKKTRKPAK CCCCCCCCCCCCCCH | 22902405 | ||
| 36 | Other | KAAVPRKKPAGPSVS HHCCCCCCCCCCCHH | - | ||
| 41 | Phosphorylation | RKKPAGPSVSELIVQ CCCCCCCCHHHHHHH | 28432305 | ||
| 43 | Phosphorylation | KPAGPSVSELIVQAV CCCCCCHHHHHHHHH | 28432305 | ||
| 54 | Other | VQAVSSSKERSGVSL HHHHHCCCCCCCCCH | - | ||
| 56 | Citrullination | AVSSSKERSGVSLAA HHHCCCCCCCCCHHH | - | ||
| 56 | Citrullination | AVSSSKERSGVSLAA HHHCCCCCCCCCHHH | - | ||
| 57 | Phosphorylation | VSSSKERSGVSLAAL HHCCCCCCCCCHHHH | 27097102 | ||
| 60 | Phosphorylation | SKERSGVSLAALKKS CCCCCCCCHHHHHHH | 28432305 | ||
| 65 | Acetylation | GVSLAALKKSLAAAG CCCHHHHHHHHHHCC | 22902405 | ||
| 66 | Other | VSLAALKKSLAAAGY CCHHHHHHHHHHCCC | - | ||
| 67 | Phosphorylation | SLAALKKSLAAAGYD CHHHHHHHHHHCCCC | 22673903 | ||
| 77 | Acetylation | AAGYDVEKNNSRIKL HCCCCCCCCCCEEEE | - | ||
| 80 | Phosphorylation | YDVEKNNSRIKLGLK CCCCCCCCEEEECHH | 23800682 | ||
| 87 | Other | SRIKLGLKSLVNKGT CEEEECHHHHHHCCC | - | ||
| 87 | Acetylation | SRIKLGLKSLVNKGT CEEEECHHHHHHCCC | 22902405 | ||
| 92 | Other | GLKSLVNKGTLVQTK CHHHHHHCCCEEEEC | - | ||
| 92 | Acetylation | GLKSLVNKGTLVQTK CHHHHHHCCCEEEEC | - | ||
| 106 | Phosphorylation | KGTGAAGSFKLNKKA CCCCCCCCEECCHHH | 28432305 | ||
| 108 | Other | TGAAGSFKLNKKAES CCCCCCEECCHHHCC | - | ||
| 108 | Acetylation | TGAAGSFKLNKKAES CCCCCCEECCHHHCC | 22902405 | ||
| 121 | Acetylation | ESKASTTKVTVKAKA CCCCCCCEEEEEEEC | - | ||
| 202 | Phosphorylation | VKVTKPKTPAKPKKA CEECCCCCCCCCCCC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H11_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 56 | R | Citrullination |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H11_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of H11_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...