UniProt ID | H10_BOVIN | |
---|---|---|
UniProt AC | Q0IIJ2 | |
Protein Name | Histone H1.0 | |
Gene Name | H1F0 | |
Organism | Bos taurus (Bovine). | |
Sequence Length | 194 | |
Subcellular Localization | Nucleus . Chromosome . | |
Protein Description | Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity).. | |
Protein Sequence | MTENSTSTPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKRSVAFKKTKKEVKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKTKKPKTVKAKPVKASKPKKTKPVKPKAKSSAKRTGKKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MTENSTST -------CCCCCCCC | 10.80 | - | |
2 | Acetylation | ------MTENSTSTP ------CCCCCCCCC | 43.82 | - | |
42 | Citrullination | AIQAEKNRAGSSRQS HHHHHHHCCCCCHHH | 51.93 | - | |
42 | Citrullination | AIQAEKNRAGSSRQS HHHHHHHCCCCCHHH | 51.93 | - | |
104 | ADP-ribosylation | KSDEPKRSVAFKKTK CCCCCCCCCCCHHHH | 24.75 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H10_BOVIN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of H10_BOVIN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H10_BOVIN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of H10_BOVIN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...