dbPTM

GTPB8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GTPB8_MOUSE
UniProt AC	Q9CY28
Protein Name	GTP-binding protein 8
Gene Name	Gtpbp8
Organism	Mus musculus (Mouse).
Sequence Length	285
Subcellular Localization
Protein Description
Protein Sequence	MAAARLSHRMGRLLEKAPALGPWTRVYSTSPAFAEVLRLPQKQLTKVVYPLRELGQHLAADSGPGLIEQRLFDPSLEDIGRAESIFEATARNRIEYLSSAVRLDHAPSLQQPEVCFIGRSNVGKSSLIKALFSLAPDVEVRISKKPGHTKKMNFFKVGKHFTLVDMPGYGYRAPEDFVDMVETYLKERNNLKRTFLLVDSVVGITKLDNIAIEMCEEFALPYVMILTKIDKSSKGYLLKQVLQIQKFVNTQTQGCFPQLFPISAVTNSGVHLLKCFIADITGSLK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
162	Phosphorylation	FKVGKHFTLVDMPGY EEECCCEEEEECCCC	26.12	22817900
169	Phosphorylation	TLVDMPGYGYRAPED EEEECCCCCCCCCHH	12.71	21183079

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GTPB8_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GTPB8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GTPB8_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GTPB8_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GTPB8_MOUSE

Related Literatures of Post-Translational Modification