UniProt ID | GSTUM_ARATH | |
---|---|---|
UniProt AC | Q8GYM1 | |
Protein Name | Glutathione S-transferase U22 | |
Gene Name | GSTU22 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 218 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.. | |
Protein Sequence | MADEVILLDFWPSPFGVRARIALREKGVEFEYREENLRDKSPLLLQMNPVHKKIPVLIHNGKPVCESMNVVQYIDEVWSDKNPILPSDPYQRAQARFWVDFVDTKLFEPADKIWQTKGEEQETAKKEYIEALKILETELGDKPYFGGDTFGFVDIAMTGYYSWFEASEKLANFSIEPECPTLMASAKRCLQRESVVQSLHDSEKILAFAYKIRKIYCV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADEVILLD ------CCCEEEEEE | 22.98 | 22223895 | |
41 | Phosphorylation | EENLRDKSPLLLQMN HHHCCCCCCEEHHCC | 25.68 | 24894044 | |
149 | Phosphorylation | KPYFGGDTFGFVDIA CCCCCCCCCCEEHHH | 29.00 | - | |
194 | Phosphorylation | KRCLQRESVVQSLHD HHHHHHHHHHHHHCC | 29.76 | 19880383 | |
198 | Phosphorylation | QRESVVQSLHDSEKI HHHHHHHHHCCHHHH | 18.96 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTUM_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTUM_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTUM_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GSTU1_ARATH | GSTU1 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...