GSTU7_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GSTU7_ARATH
• UniProt AC: Q9ZW24
• Protein Name: Glutathione S-transferase U7
• Gene Name: GSTU7
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 227
• Subcellular Localization: Cytoplasm, cytosol .
• Protein Description: May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides..
• Protein Sequence: MAERSNSEEVKLLGMWASPFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKMIPVLVHNGKPISESLVILEYIDETWRDNPILPQDPYERTMARFWSKFVDEQIYVTAMKVVGKTGKERDAVVEATRDLLMFLEKELVGKDFLGGKSLGFVDIVATLVAFWLMRTEEIVGVKVVPVEKFPEIHRWVKNLLGNDVIKKCIPPEDEHLKYIRARMEKLNIKSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	KLLGMWASPFSRRIE HHHHEECCCCHHHHH	15.80	22074104
21	Phosphorylation	GMWASPFSRRIEIAL HEECCCCHHHHHHHH	24.84	22074104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GSTU7_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GSTU7_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GSTU7_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSTU1_ARATH	GSTU1	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.