| UniProt ID | GSTT2_HUMAN | |
|---|---|---|
| UniProt AC | P0CG30 | |
| Protein Name | Glutathione S-transferase theta-2B | |
| Gene Name | GSTT2B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 244 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.. | |
| Protein Sequence | MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Ubiquitination | AVYIFAKKNGIPLEL EEEEEEHHHCCEEEE | 57.91 | - | |
| 37 | Ubiquitination | LRTVDLVKGQHKSKE EEEHHHCCCCCCCCC | 61.21 | - | |
| 43 | Ubiquitination | VKGQHKSKEFLQINS CCCCCCCCCEEEECC | 58.24 | - | |
| 53 | Acetylation | LQINSLGKLPTLKDG EEECCCCCCCCCCCC | 57.49 | 54384443 | |
| 53 | Ubiquitination | LQINSLGKLPTLKDG EEECCCCCCCCCCCC | 57.49 | - | |
| 98 | Phosphorylation | ARARVHEYLGWHADC HHHHHHHHHCCHHHH | 8.81 | - | |
| 137 | Phosphorylation | EKVERNRTAMDQALQ HHHHHHHHHHHHHHH | 29.86 | 20068231 | |
| 227 | Phosphorylation | AAKKTLPTPSPEAYQ HHHHCCCCCCHHHHH | 39.24 | 24719451 | |
| 229 | Phosphorylation | KKTLPTPSPEAYQAM HHCCCCCCHHHHHHH | 37.54 | 24719451 | |
| 233 | Phosphorylation | PTPSPEAYQAMLLRI CCCCHHHHHHHHHHH | 8.64 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTT2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTT2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTT2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GSTP1_HUMAN | GSTP1 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
