UniProt ID | GSTM5_MOUSE | |
---|---|---|
UniProt AC | P48774 | |
Protein Name | Glutathione S-transferase Mu 5 | |
Gene Name | Gstm5 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 224 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.. | |
Protein Sequence | MSSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYICGEAPDYDRSQWLDVKFKLDLDFPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYNSNHENLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRIFEPKCLDEFPNLKAFMCRFEALEKIAAFLQSDRFFKMPINNKMAKWGNKCLC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Ubiquitination | ----MSSKSMVLGYW ----CCCCCCHHCHH | 34.95 | 22790023 | |
4 | Sumoylation | ----MSSKSMVLGYW ----CCCCCCHHCHH | 34.95 | 28289178 | |
5 | Phosphorylation | ---MSSKSMVLGYWD ---CCCCCCHHCHHH | 18.97 | 19186949 | |
34 | Ubiquitination | TDTSYEEKRYICGEA CCCCHHHHCCCCCCC | 38.26 | 22790023 | |
38 | S-palmitoylation | YEEKRYICGEAPDYD HHHHCCCCCCCCCCC | 2.74 | 28526873 | |
38 | S-nitrosylation | YEEKRYICGEAPDYD HHHHCCCCCCCCCCC | 2.74 | 21278135 | |
38 | S-nitrosocysteine | YEEKRYICGEAPDYD HHHHCCCCCCCCCCC | 2.74 | - | |
70 | Ubiquitination | LPYLMDGKNKITQSN CCEEECCCCCHHCHH | 51.29 | 22790023 | |
72 | Ubiquitination | YLMDGKNKITQSNAI EEECCCCCHHCHHHH | 51.09 | 22790023 | |
76 | Phosphorylation | GKNKITQSNAILRYI CCCCHHCHHHHHHHH | 21.41 | 26643407 | |
86 | Acetylation | ILRYIARKHNMCGDT HHHHHHHHCCCCCCC | 30.24 | 22826441 | |
90 | S-nitrosocysteine | IARKHNMCGDTEEEK HHHHCCCCCCCCHHH | 5.60 | - | |
90 | S-nitrosylation | IARKHNMCGDTEEEK HHHHCCCCCCCCHHH | 5.60 | 21278135 | |
93 | Phosphorylation | KHNMCGDTEEEKIRV HCCCCCCCCHHHHHH | 30.49 | 29514104 | |
119 | Phosphorylation | MQLVRLCYNSNHENL HHHHHHHHCCCCCCC | 26.64 | 29899451 | |
121 | Phosphorylation | LVRLCYNSNHENLKP HHHHHHCCCCCCCCH | 17.06 | 29899451 | |
127 | Ubiquitination | NSNHENLKPQYLEQL CCCCCCCCHHHHHHH | 41.47 | 22790023 | |
127 | Acetylation | NSNHENLKPQYLEQL CCCCCCCCHHHHHHH | 41.47 | 22826441 | |
176 | Ubiquitination | QNRIFEPKCLDEFPN CCCCCCCHHHHCCCC | 39.99 | 22790023 | |
196 | Acetylation | CRFEALEKIAAFLQS HHHHHHHHHHHHHHC | 38.20 | 22826441 | |
208 | Ubiquitination | LQSDRFFKMPINNKM HHCCCCCCCCCCCCC | 40.84 | 22790023 | |
214 | Ubiquitination | FKMPINNKMAKWGNK CCCCCCCCCCCCCCC | 35.43 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTM5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTM5_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTM5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GSTM5_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...