| UniProt ID | GSTM5_MOUSE | |
|---|---|---|
| UniProt AC | P48774 | |
| Protein Name | Glutathione S-transferase Mu 5 | |
| Gene Name | Gstm5 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 224 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.. | |
| Protein Sequence | MSSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYICGEAPDYDRSQWLDVKFKLDLDFPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYNSNHENLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRIFEPKCLDEFPNLKAFMCRFEALEKIAAFLQSDRFFKMPINNKMAKWGNKCLC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Ubiquitination | ----MSSKSMVLGYW ----CCCCCCHHCHH | 34.95 | 22790023 | |
| 4 | Sumoylation | ----MSSKSMVLGYW ----CCCCCCHHCHH | 34.95 | 28289178 | |
| 5 | Phosphorylation | ---MSSKSMVLGYWD ---CCCCCCHHCHHH | 18.97 | 19186949 | |
| 34 | Ubiquitination | TDTSYEEKRYICGEA CCCCHHHHCCCCCCC | 38.26 | 22790023 | |
| 38 | S-palmitoylation | YEEKRYICGEAPDYD HHHHCCCCCCCCCCC | 2.74 | 28526873 | |
| 38 | S-nitrosylation | YEEKRYICGEAPDYD HHHHCCCCCCCCCCC | 2.74 | 21278135 | |
| 38 | S-nitrosocysteine | YEEKRYICGEAPDYD HHHHCCCCCCCCCCC | 2.74 | - | |
| 70 | Ubiquitination | LPYLMDGKNKITQSN CCEEECCCCCHHCHH | 51.29 | 22790023 | |
| 72 | Ubiquitination | YLMDGKNKITQSNAI EEECCCCCHHCHHHH | 51.09 | 22790023 | |
| 76 | Phosphorylation | GKNKITQSNAILRYI CCCCHHCHHHHHHHH | 21.41 | 26643407 | |
| 86 | Acetylation | ILRYIARKHNMCGDT HHHHHHHHCCCCCCC | 30.24 | 22826441 | |
| 90 | S-nitrosocysteine | IARKHNMCGDTEEEK HHHHCCCCCCCCHHH | 5.60 | - | |
| 90 | S-nitrosylation | IARKHNMCGDTEEEK HHHHCCCCCCCCHHH | 5.60 | 21278135 | |
| 93 | Phosphorylation | KHNMCGDTEEEKIRV HCCCCCCCCHHHHHH | 30.49 | 29514104 | |
| 119 | Phosphorylation | MQLVRLCYNSNHENL HHHHHHHHCCCCCCC | 26.64 | 29899451 | |
| 121 | Phosphorylation | LVRLCYNSNHENLKP HHHHHHCCCCCCCCH | 17.06 | 29899451 | |
| 127 | Ubiquitination | NSNHENLKPQYLEQL CCCCCCCCHHHHHHH | 41.47 | 22790023 | |
| 127 | Acetylation | NSNHENLKPQYLEQL CCCCCCCCHHHHHHH | 41.47 | 22826441 | |
| 176 | Ubiquitination | QNRIFEPKCLDEFPN CCCCCCCHHHHCCCC | 39.99 | 22790023 | |
| 196 | Acetylation | CRFEALEKIAAFLQS HHHHHHHHHHHHHHC | 38.20 | 22826441 | |
| 208 | Ubiquitination | LQSDRFFKMPINNKM HHCCCCCCCCCCCCC | 40.84 | 22790023 | |
| 214 | Ubiquitination | FKMPINNKMAKWGNK CCCCCCCCCCCCCCC | 35.43 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTM5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTM5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTM5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GSTM5_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...