UniProt ID | GSTM2_MOUSE | |
---|---|---|
UniProt AC | P15626 | |
Protein Name | Glutathione S-transferase Mu 2 | |
Gene Name | Gstm2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 218 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.. | |
Protein Sequence | MPMTLGYWDIRGLAHAIRLLLEYTDTSYEDKKYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHNLCGETEEERIRVDILENQAMDTRIQLAMVCYSPDFEKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKVTYVDFLVYDVLDQHRIFEPKCLDAFPNLKDFMGRFEGLKKISDYMKSSRFLSKPIFAKMAFWNPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | LLEYTDTSYEDKKYT HHHCCCCCHHCCCCC | 29.36 | - | |
31 | Acetylation | TDTSYEDKKYTMGDA CCCCHHCCCCCCCCC | 35.42 | 19864859 | |
31 | Ubiquitination | TDTSYEDKKYTMGDA CCCCHHCCCCCCCCC | 35.42 | 22790023 | |
32 | Acetylation | DTSYEDKKYTMGDAP CCCHHCCCCCCCCCC | 59.27 | 22826441 | |
34 | Phosphorylation | SYEDKKYTMGDAPDY CHHCCCCCCCCCCCC | 24.45 | 20139300 | |
44 | Phosphorylation | DAPDYDRSQWLSEKF CCCCCCHHHHHHHHH | 23.86 | - | |
50 | Ubiquitination | RSQWLSEKFKLGLDF HHHHHHHHHCCCCCC | 44.41 | 22790023 | |
52 | Acetylation | QWLSEKFKLGLDFPN HHHHHHHCCCCCCCC | 53.35 | 7872623 | |
52 | Ubiquitination | QWLSEKFKLGLDFPN HHHHHHHCCCCCCCC | 53.35 | 22790023 | |
62 | Phosphorylation | LDFPNLPYLIDGSHK CCCCCCCEEECCCCC | 21.32 | 23984901 | |
67 | Phosphorylation | LPYLIDGSHKITQSN CCEEECCCCCCCCHH | 20.19 | 21082442 | |
69 | Acetylation | YLIDGSHKITQSNAI EEECCCCCCCCHHHH | 49.50 | 7872633 | |
69 | Ubiquitination | YLIDGSHKITQSNAI EEECCCCCCCCHHHH | 49.50 | - | |
71 | Phosphorylation | IDGSHKITQSNAILR ECCCCCCCCHHHHHH | 30.65 | 23984901 | |
73 | Phosphorylation | GSHKITQSNAILRYL CCCCCCCHHHHHHHH | 21.41 | 23984901 | |
83 | Ubiquitination | ILRYLARKHNLCGET HHHHHHHHCCCCCCC | 31.10 | 22790023 | |
87 | S-nitrosylation | LARKHNLCGETEEER HHHHCCCCCCCHHHH | 5.85 | 21278135 | |
87 | S-nitrosocysteine | LARKHNLCGETEEER HHHHCCCCCCCHHHH | 5.85 | - | |
115 | S-nitrosylation | RIQLAMVCYSPDFEK HHHHHHHHHCCCHHH | 1.46 | 21278135 | |
115 | S-nitrosocysteine | RIQLAMVCYSPDFEK HHHHHHHHHCCCHHH | 1.46 | - | |
117 | Phosphorylation | QLAMVCYSPDFEKKK HHHHHHHCCCHHHCC | 16.93 | 26643407 | |
136 | Malonylation | EGLPEKMKLYSEFLG CCCCHHHHHHHHHHC | 56.17 | 26320211 | |
136 | Acetylation | EGLPEKMKLYSEFLG CCCCHHHHHHHHHHC | 56.17 | 22733758 | |
136 | Ubiquitination | EGLPEKMKLYSEFLG CCCCHHHHHHHHHHC | 56.17 | - | |
139 | Phosphorylation | PEKMKLYSEFLGKQP CHHHHHHHHHHCCCC | 32.10 | 26643407 | |
144 | Acetylation | LYSEFLGKQPWFAGN HHHHHHCCCCCCCCC | 56.16 | 23954790 | |
144 | Ubiquitination | LYSEFLGKQPWFAGN HHHHHHCCCCCCCCC | 56.16 | 22790023 | |
173 | Acetylation | QHRIFEPKCLDAFPN HCCCCCHHHHHHCCC | 39.99 | 22733758 | |
174 | S-nitrosylation | HRIFEPKCLDAFPNL CCCCCHHHHHHCCCH | 6.43 | 21278135 | |
174 | S-nitrosocysteine | HRIFEPKCLDAFPNL CCCCCHHHHHHCCCH | 6.43 | - | |
192 | Acetylation | MGRFEGLKKISDYMK HHHHHHHHHHHHHHH | 59.94 | 2372787 | |
199 | Malonylation | KKISDYMKSSRFLSK HHHHHHHHHHCCCCC | 38.76 | 26320211 | |
199 | Acetylation | KKISDYMKSSRFLSK HHHHHHHHHHCCCCC | 38.76 | 23954790 | |
205 | Phosphorylation | MKSSRFLSKPIFAKM HHHHCCCCCCHHHHH | 33.40 | - | |
206 | Ubiquitination | KSSRFLSKPIFAKMA HHHCCCCCCHHHHHH | 44.26 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTM2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTM2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTM2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GSTM2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...