| UniProt ID | GSTF9_ARATH | |
|---|---|---|
| UniProt AC | O80852 | |
| Protein Name | Glutathione S-transferase F9 | |
| Gene Name | GSTF9 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 215 | |
| Subcellular Localization | Cytoplasm, cytosol . | |
| Protein Description | In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC), and glutathione peroxidase activity toward cumene hydroperoxide and linoleic acid-13-hydroperoxide. May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.. | |
| Protein Sequence | MVLKVYGPHFASPKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKDRKHVSAWWDDISSRPAWKETVAKYSFPA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MVLKVYGPHFASP --CCEEEECCCCCCH | 24.29 | 23776212 | |
| 12 | Phosphorylation | VYGPHFASPKRALVT EECCCCCCHHHHHHH | 29.97 | 30291188 | |
| 35 | Sulfoxidation | ETIPVDLMKGEHKQP EEECHHHCCCCCCCC | 4.54 | 25693801 | |
| 79 | Phosphorylation | YVAEKYRSQGPDLLG HHHHHHHHHCCCCCC | 36.08 | 19880383 | |
| 88 | Phosphorylation | GPDLLGKTVEDRGQV CCCCCCCCHHHCCCE | 27.59 | 29654922 | |
| 118 | Sulfoxidation | LNLTLHIMFASVMGF HHHHHHHHHHHHHCC | 1.27 | 29732642 | |
| 123 | Sulfoxidation | HIMFASVMGFPSDEK HHHHHHHHCCCCCHH | 4.19 | 29732642 | |
| 184 | Sulfoxidation | GPIGKAYMIKDRKHV CCCCCEEEECCCCCC | 3.52 | 29732642 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTF9_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTF9_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTF9_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GSTF9_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
