GSTD4_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GSTD4_DROME
• UniProt AC: Q9VG96
• Protein Name: Glutathione S-transferase D4 {ECO:0000303|PubMed:22082028}
• Gene Name: GstD4 {ECO:0000312|FlyBase:FBgn0010040}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 215
• Protein Description: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [PubMed: 22082028 May be involved in detoxification]
• Protein Sequence: MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVARWYANAKKITPGWDENWKGLLQMKTMYEAQKASLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GSTD4_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GSTD4_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GSTD4_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GSTD4_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSTD6_DROME	GstD6	physical	14605208
GSTD5_DROME	GstD5	physical	22036573
GSTD7_DROME	GstD7	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.