| UniProt ID | GSTA4_MOUSE | |
|---|---|---|
| UniProt AC | P24472 | |
| Protein Name | Glutathione S-transferase A4 | |
| Gene Name | Gsta4 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 222 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.. | |
| Protein Sequence | MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MAAKPKLY -------CCCCCEEE | 8.05 | - | |
| 6 | Ubiquitination | --MAAKPKLYYFNGR --CCCCCEEEEECCC | 48.71 | - | |
| 6 | Succinylation | --MAAKPKLYYFNGR --CCCCCEEEEECCC | 48.71 | 23954790 | |
| 84 | Acetylation | AKYNLYGKDLKERVR HHHCCCCCCHHHHHE | 46.46 | 23954790 | |
| 84 | Succinylation | AKYNLYGKDLKERVR HHHCCCCCCHHHHHE | 46.46 | 23954790 | |
| 117 | Acetylation | PFKTPKEKEESYDLI CCCCCCHHHHCHHHH | 73.28 | 23954790 | |
| 130 | Phosphorylation | LILSRAKTRYFPVFE HHHHHHHHCCHHHHH | 29.62 | 29899451 | |
| 195 | Malonylation | ISNIPTIKKFLQPGS HHCCCHHHHHCCCCC | 39.69 | 26320211 | |
| 195 | Succinylation | ISNIPTIKKFLQPGS HHCCCHHHHHCCCCC | 39.69 | 23954790 | |
| 196 | Acetylation | SNIPTIKKFLQPGSQ HCCCHHHHHCCCCCC | 47.67 | 22733758 | |
| 196 | Ubiquitination | SNIPTIKKFLQPGSQ HCCCHHHHHCCCCCC | 47.67 | 22790023 | |
| 196 | Malonylation | SNIPTIKKFLQPGSQ HCCCHHHHHCCCCCC | 47.67 | 26320211 | |
| 202 | Phosphorylation | KKFLQPGSQRKPPPD HHHCCCCCCCCCCCC | 33.23 | 30352176 | |
| 212 | Phosphorylation | KPPPDGPYVEVVRTV CCCCCCCCHHEEEEH | 18.12 | 29514104 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTA4_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTA4_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTA4_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GSTA4_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
