UniProt ID | GSK31_SCHPO | |
---|---|---|
UniProt AC | Q9URT9 | |
Protein Name | Protein kinase gsk31 | |
Gene Name | gsk31 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 381 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSDDSHLETKVVTDGTTGEKKTISYEPCRVLGSGSFGVVIQAKLVGTPGFIAVKRVLQDKRYKNRELQIMRAISHPNIIKLIAFFHTHNPSKDETHLCLLLEYMPETVFDDMRWYTRRRKSIPNLSIKLYAFQLFRALAYLHSTGVCHRDIKPQNLLVDYKTGILKLCDFGSAKVLVPSEPNVSYICSRYYRAPELVFGATHYTTKIDVWSAACVIAELFIGRPLFPGDSSVEQLVEIIRVLGTPSYHEISVMNPNYVNHSLPNVRPHTLESVMPHNCTKNAMDLLHKMLTYVPSKRISAIEVLTHPFFDELRDPNCMYHCSRDEGTIERHLPPLFNFNLAELSIRPNLNKAILPPHVYESLDVDINNFEPIVVKQADADS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSDDSHLET ------CCCCCCCEE | 50.56 | 21712547 | |
5 | Phosphorylation | ---MSDDSHLETKVV ---CCCCCCCEEEEE | 34.66 | 21712547 | |
121 | Phosphorylation | WYTRRRKSIPNLSIK HHHCCCCCCCCCHHH | 41.28 | 28889911 | |
179 | Phosphorylation | SAKVLVPSEPNVSYI CCEEECCCCCCHHHH | 59.20 | 29996109 | |
184 | Phosphorylation | VPSEPNVSYICSRYY CCCCCCHHHHCCCCC | 18.54 | 28889911 | |
185 | Phosphorylation | PSEPNVSYICSRYYR CCCCCHHHHCCCCCC | 11.15 | 28889911 | |
188 | Phosphorylation | PNVSYICSRYYRAPE CCHHHHCCCCCCCCH | 17.48 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSK31_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSK31_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSK31_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GSK31_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...