UniProt ID | GRP_HUMAN | |
---|---|---|
UniProt AC | P07492 | |
Protein Name | Gastrin-releasing peptide | |
Gene Name | GRP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization | Secreted . Cytoplasmic vesicle, secretory vesicle lumen . | |
Protein Description | Stimulates the release of gastrin and other gastrointestinal hormones (By similarity). Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior. Contributes primarily to nonhistaminergic itch sensation. Contributes to long-term fear memory, but not normal spatial memory. Contributes to the regulation of food intake (By similarity).. | |
Protein Sequence | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | PLPAGGGTVLTKMYP CCCCCCCEEEEEEEE | 18.67 | - | |
50 | Methionine amide | HWAVGHLMGKKSTGE CEEHHHHCCCCCCCC | 6.49 | - | |
50 | Amidation | HWAVGHLMGKKSTGE CEEHHHHCCCCCCCC | 6.49 | 3211139 | |
50 | Methylation | HWAVGHLMGKKSTGE CEEHHHHCCCCCCCC | 6.49 | 3211139 | |
52 | Ubiquitination | AVGHLMGKKSTGESS EHHHHCCCCCCCCCC | 29.59 | - | |
53 | Ubiquitination | VGHLMGKKSTGESSS HHHHCCCCCCCCCCC | 47.74 | - | |
68 | Acetylation | VSERGSLKQQLREYI HHHHCCHHHHHHHHH | 37.38 | 19814805 | |
127 | Acetylation | KDVGSKGKVGRLSAP CCCCCCCCEEEECCC | 45.30 | 19820049 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GRP_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Amidation | |
Reference | PubMed |
"Posttranslational processing of endogenous and of baculovirus-expressed human gastrin-releasing peptide precursor."; Lebacq-Verheyden A.-M., Kasprzyk P.G., Raum M.G.,van Wyke Coelingh K., Lebacq J.A., Battey J.F.; Mol. Cell. Biol. 8:3129-3135(1988). Cited for: NUCLEOTIDE SEQUENCE [MRNA], AND AMIDATION AT MET-50. |