dbPTM

GRPE_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GRPE_CAEEL
UniProt AC	Q18421
Protein Name	GrpE protein homolog, mitochondrial
Gene Name	C34C12.8
Organism	Caenorhabditis elegans.
Sequence Length	237
Subcellular Localization	Mitochondrion matrix.
Protein Description	Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins (By similarity)..
Protein Sequence	MLRKGVSFVGQAVQQTLKTQKNLRIQRFSATASQSSEEVNYEIRKDGKRLRGADYEEIVLTSIAGEDKTQIPKGAFDVLLKEYDDLQAESLDFKDKYQRSLAETENVRRRGIKQTDDAKVFAIQSFCKDLLEVSDILDIAVKSVKPEDLESGGKALKDLFEGVSMTRTVMAKTFAKHGLVTVDPTNEKFDPNLHEAVFQIPSANAKQPVGHIEVCTKIGYSLKERPIRPAQVGVVSK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of GRPE_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GRPE_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GRPE_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GRPE_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GRPE_CAEEL

Related Literatures of Post-Translational Modification