UniProt ID | GRPE1_RAT | |
---|---|---|
UniProt AC | P97576 | |
Protein Name | GrpE protein homolog 1, mitochondrial | |
Gene Name | Grpel1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 217 | |
Subcellular Localization | Mitochondrion matrix. | |
Protein Description | Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.. | |
Protein Sequence | MAARCVRLARRSLPALALSFRPSPRLLCTATKQKNNGQNLEEDLGHCEPKTDPSSADKTLLEEKVKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEKATQSVPKEEVSNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKDA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Acetylation | DKTLLEEKVKLEEQL CHHHHHHHHHHHHHH | 34.98 | 22902405 | |
66 | Acetylation | TLLEEKVKLEEQLKE HHHHHHHHHHHHHHH | 62.34 | 22902405 | |
72 | Acetylation | VKLEEQLKETMEKYK HHHHHHHHHHHHHHH | 51.32 | 22902405 | |
77 | Acetylation | QLKETMEKYKRALAD HHHHHHHHHHHHHHC | 45.29 | 22902405 | |
94 | Acetylation | NLRQRSQKLVEEAKL HHHHHHHHHHHHHHH | 56.60 | 22902405 | |
94 | Succinylation | NLRQRSQKLVEEAKL HHHHHHHHHHHHHHH | 56.60 | - | |
94 | Succinylation | NLRQRSQKLVEEAKL HHHHHHHHHHHHHHH | 56.60 | - | |
100 | Acetylation | QKLVEEAKLYGIQGF HHHHHHHHHHCCHHH | 45.59 | - | |
120 | Succinylation | EVADILEKATQSVPK HHHHHHHHHHCCCCH | 53.97 | - | |
120 | Succinylation | EVADILEKATQSVPK HHHHHHHHHHCCCCH | 53.97 | - | |
157 | Acetylation | QIQKVFTKHGLLRLD HHHHHHHHCCCEEEC | 24.98 | 22902405 | |
186 | Acetylation | FHTPVEGKEPGTVAL CCCCCCCCCCCCEEE | 47.43 | 22902405 | |
215 | Acetylation | PALVGVVKDA----- HHHHEEECCC----- | 45.60 | 22902405 | |
215 | Succinylation | PALVGVVKDA----- HHHHEEECCC----- | 45.60 | - | |
215 | Succinylation | PALVGVVKDA----- HHHHEEECCC----- | 45.60 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRPE1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRPE1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRPE1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...