| UniProt ID | GRPE1_RAT | |
|---|---|---|
| UniProt AC | P97576 | |
| Protein Name | GrpE protein homolog 1, mitochondrial | |
| Gene Name | Grpel1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 217 | |
| Subcellular Localization | Mitochondrion matrix. | |
| Protein Description | Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.. | |
| Protein Sequence | MAARCVRLARRSLPALALSFRPSPRLLCTATKQKNNGQNLEEDLGHCEPKTDPSSADKTLLEEKVKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEKATQSVPKEEVSNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKDA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 64 | Acetylation | DKTLLEEKVKLEEQL CHHHHHHHHHHHHHH | 34.98 | 22902405 | |
| 66 | Acetylation | TLLEEKVKLEEQLKE HHHHHHHHHHHHHHH | 62.34 | 22902405 | |
| 72 | Acetylation | VKLEEQLKETMEKYK HHHHHHHHHHHHHHH | 51.32 | 22902405 | |
| 77 | Acetylation | QLKETMEKYKRALAD HHHHHHHHHHHHHHC | 45.29 | 22902405 | |
| 94 | Acetylation | NLRQRSQKLVEEAKL HHHHHHHHHHHHHHH | 56.60 | 22902405 | |
| 94 | Succinylation | NLRQRSQKLVEEAKL HHHHHHHHHHHHHHH | 56.60 | - | |
| 94 | Succinylation | NLRQRSQKLVEEAKL HHHHHHHHHHHHHHH | 56.60 | - | |
| 100 | Acetylation | QKLVEEAKLYGIQGF HHHHHHHHHHCCHHH | 45.59 | - | |
| 120 | Succinylation | EVADILEKATQSVPK HHHHHHHHHHCCCCH | 53.97 | - | |
| 120 | Succinylation | EVADILEKATQSVPK HHHHHHHHHHCCCCH | 53.97 | - | |
| 157 | Acetylation | QIQKVFTKHGLLRLD HHHHHHHHCCCEEEC | 24.98 | 22902405 | |
| 186 | Acetylation | FHTPVEGKEPGTVAL CCCCCCCCCCCCEEE | 47.43 | 22902405 | |
| 215 | Acetylation | PALVGVVKDA----- HHHHEEECCC----- | 45.60 | 22902405 | |
| 215 | Succinylation | PALVGVVKDA----- HHHHEEECCC----- | 45.60 | - | |
| 215 | Succinylation | PALVGVVKDA----- HHHHEEECCC----- | 45.60 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRPE1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRPE1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRPE1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...