UniProt ID | GRN_RAT | |
---|---|---|
UniProt AC | P23785 | |
Protein Name | Granulins | |
Gene Name | Grn | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 588 | |
Subcellular Localization | Secreted. | |
Protein Description | Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling.. | |
Protein Sequence | MWILVSWLALVARLVAGTQCPDGQFCPVACCLDQGGANYSCCNPLLDTWPIITSRRLDGSCQIRDHCPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFHCSADGKSCSQISDSLLGAVQCPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLLKKFPAQRTNRAVASFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDLMTKLPGYPVNEVKCDLEVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQILKNDVPCDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKCMDEGYCQKGDRMVAGLEKMPVRQTTLLQHGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDAGSVQPSMDLTFGSKVGNVECGAGHFCHDNQSCCKDSQGGWACCPYVKGVCCRDGRHCCPIGFHCSAKGTKCLRKKTPRWDILLRDPAPRPLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | N-linked_Glycosylation | CLDQGGANYSCCNPL EEECCCCCCCCCCHH | 32.31 | - | |
372 | N-linked_Glycosylation | DFSSCPSNNTCCRLS CCCCCCCCCCEEECC | 32.73 | - | |
525 | N-linked_Glycosylation | AGHFCHDNQSCCKDS CCCEECCCCCCCCCC | 16.40 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRN_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRN_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRN_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GRN_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...