UniProt ID | GRK7_HUMAN | |
---|---|---|
UniProt AC | Q8WTQ7 | |
Protein Name | Rhodopsin kinase | |
Gene Name | GRK7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 553 | |
Subcellular Localization |
Membrane Lipid-anchor . |
|
Protein Description | Retina-specific kinase involved in the shutoff of the photoresponse and adaptation to changing light conditions via cone opsin phosphorylation, including rhodopsin (RHO).. | |
Protein Sequence | MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPGNPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKLFEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKGGEKMALLEKEILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQIACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQRAGTNGYMAPEILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFTEEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | YLQARKPSDCDSKEL HHHCCCCCCCCHHHH | 54.64 | 22817900 | |
36 | Phosphorylation | ELQRRRRSLALPGLQ HHHHHHHHHHCCCHH | 19.04 | 22817900 | |
85 | Phosphorylation | PTFRKAATFLEDVQN HHHHHHHHHHHHHHC | 33.34 | 27251275 | |
229 | Acetylation | LDKKRLKKKGGEKMA CCHHHHHHCCCHHHH | 62.33 | 130811 | |
230 | Acetylation | DKKRLKKKGGEKMAL CHHHHHHCCCHHHHH | 71.24 | 130813 | |
234 | Acetylation | LKKKGGEKMALLEKE HHHCCCHHHHHHHHH | 32.52 | 130815 | |
433 | Acetylation | ICRLFLAKKPEQRLG HHHHHHCCCHHHCCC | 71.64 | 7308127 | |
490 | Phosphorylation | IAEIDDFSEVRGVEF HHHCCCCHHCCCCCC | 42.02 | 24719451 | |
550 | Methylation | NSSKSGVCLLL---- CCCCCCEEEEC---- | 2.24 | - | |
550 | Geranylgeranylation | NSSKSGVCLLL---- CCCCCCEEEEC---- | 2.24 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
23 | S | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
23 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
23 | S | Phosphorylation | Kinase | PKA_GROUP | - | PhosphoELM |
36 | S | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
36 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
36 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
36 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
36 | S | Phosphorylation | Kinase | PKA_GROUP | - | PhosphoELM |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRK7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GRK7_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...