UniProt ID | GRCR1_HUMAN | |
---|---|---|
UniProt AC | A8MXD5 | |
Protein Name | Glutaredoxin domain-containing cysteine-rich protein 1 | |
Gene Name | GRXCR1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 290 | |
Subcellular Localization | Cell projection, stereocilium. Cell projection, microvillus. Cell projection, kinocilium. In the inner ear, localized to stereocilia, apical microvilli of sensory cells and kinocilia.. | |
Protein Description | May play a role in actin filament architecture in developing stereocilia of sensory cells.. | |
Protein Sequence | MLKREMKPESDRPRKVRFRIASSHSGRVLKEVYEDGQPSGSLDSECASICGIDGLGDSDGQQNGHIESEGDENENDQDSLLVLARAASEKGFGTRRVNILSKNGTVRGVKYKVSAGQALFNNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDILTKIERVQHPHECPSCGGFGFLPCSVCHGSKMSMFRNCFTDSFKALKCTACNENGLQRCKNCAG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | KVRFRIASSHSGRVL CEEEEEEECCCCCEE | 26.64 | 18785766 | |
111 | Phosphorylation | GTVRGVKYKVSAGQA CCCCCEEEEEEHHHH | 17.76 | - | |
125 | Ubiquitination | ALFNNLTKVLQQPST HHHHHHHHHHHCCCC | 44.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRCR1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRCR1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRCR1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GRCR1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
613285 | Deafness, autosomal recessive, 25 (DFNB25) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...