| UniProt ID | GRC10_ARATH | |
|---|---|---|
| UniProt AC | Q29PZ1 | |
| Protein Name | Glutaredoxin-C10 | |
| Gene Name | GRXC10 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 148 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins (By similarity).. | |
| Protein Sequence | MKTMRGLRNCSNDAVTLDLTVHPPPPPPLPPPAPSTVSSSTASTSLSFDEEETSESKIGRLISEHPVIIFTRFSSCCMCHVMKKLLSTVGVHPTVIEIDDGEIAYLAVEAAPVLFIGGTCVGGFESLVALHLSGQLIPRLVEVGALWA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of GRC10_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRC10_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRC10_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRC10_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GRC10_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
