UniProt ID | GPX2_ARATH | |
---|---|---|
UniProt AC | O04922 | |
Protein Name | Probable glutathione peroxidase 2 | |
Gene Name | GPX2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 169 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus . | |
Protein Description | May constitute a glutathione peroxidase-like protective system against oxidative stresses.. | |
Protein Sequence | MADESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALGQASS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MADESPKSIYDF ---CCCCCCCCEEEE | 37.87 | 27643528 | |
8 | Phosphorylation | MADESPKSIYDFTVK CCCCCCCCEEEEEEE | 29.75 | 27643528 | |
10 | Phosphorylation | DESPKSIYDFTVKDI CCCCCCEEEEEEEEC | 16.46 | 27643528 | |
168 | Phosphorylation | QTALGQASS------ HHHHHHCCC------ | 28.79 | 29654922 | |
169 | Phosphorylation | TALGQASS------- HHHHHCCC------- | 47.45 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPX2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPX2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPX2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GPX2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...