GPX2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GPX2_ARATH
• UniProt AC: O04922
• Protein Name: Probable glutathione peroxidase 2
• Gene Name: GPX2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 169
• Subcellular Localization: Cytoplasm, cytosol . Nucleus .
• Protein Description: May constitute a glutathione peroxidase-like protective system against oxidative stresses..
• Protein Sequence: MADESPKSIYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDKVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDIQTALGQASS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MADESPKSIYDF ---CCCCCCCCEEEE	37.87	27643528
8	Phosphorylation	MADESPKSIYDFTVK CCCCCCCCEEEEEEE	29.75	27643528
10	Phosphorylation	DESPKSIYDFTVKDI CCCCCCEEEEEEEEC	16.46	27643528
168	Phosphorylation	QTALGQASS------ HHHHHHCCC------	28.79	29654922
169	Phosphorylation	TALGQASS------- HHHHHCCC-------	47.45	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GPX2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GPX2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GPX2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of GPX2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.