dbPTM

GPI8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GPI8_MOUSE
UniProt AC	Q9CXY9
Protein Name	GPI-anchor transamidase
Gene Name	Pigk
Organism	Mus musculus (Mouse).
Sequence Length	395
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type I membrane protein.
Protein Description	Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein (By similarity)..
Protein Sequence	MAAPCFLTLRVATLAALALLSLGSSAAGHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNARNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRVPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTEKISLQWDSQVVDSSSKEDGTAEERMGPLKYAEQLPVAQIIHQKPKPRDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
80	Phosphorylation	KRLGIPDSHIVLMLA HHHCCCCCCEEEEEE	15.12	28059163
101	Phosphorylation	ARNPKPATVFSHKNM CCCCCCCEEEEECCE	30.52	28059163
123	O-linked_Glycosylation	DVEVDYRSYEVTVEN CEEECEEEEEEEHHH	21.29	30059200
329	Phosphorylation	DSQVVDSSSKEDGTA CCEEECCCCCCCCCH	40.75	25338131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GPI8_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GPI8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GPI8_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GPI8_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GPI8_MOUSE

Related Literatures of Post-Translational Modification