UniProt ID | GP1BB_MOUSE | |
---|---|---|
UniProt AC | P56400 | |
Protein Name | Platelet glycoprotein Ib beta chain | |
Gene Name | Gp1bb | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 206 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.. | |
Protein Sequence | MGSRPRGALSLLLLLLALLSRPASGCPAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Methylation | --MGSRPRGALSLLL --CCCCHHHHHHHHH | 41.74 | - | |
41 | Methylation | GTLVDCGRRGLTWAS CEEEECCCCCCEECC | 35.51 | - | |
66 | N-linked_Glycosylation | ELVLTGNNLTALPPG EEEEECCCCCCCCCC | 39.86 | - | |
186 | Phosphorylation | RARARARSIQEFSLT HHHHHHHCCHHHCCC | 27.86 | 25521595 | |
191 | Phosphorylation | ARSIQEFSLTAPLVA HHCCHHHCCCHHHHH | 24.86 | 24704852 | |
193 | Phosphorylation | SIQEFSLTAPLVAES CCHHHCCCHHHHHHH | 25.65 | 24704852 | |
200 | Phosphorylation | TAPLVAESARGGAS- CHHHHHHHHCCCCC- | 17.33 | 19060867 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GP1BB_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GP1BB_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GP1BB_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GP1BB_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...