GOS11_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GOS11_ARATH
• UniProt AC: Q9LMP7
• Protein Name: Golgi SNAP receptor complex member 1-1
• Gene Name: GOS11
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 223
• Subcellular Localization: Golgi apparatus membrane; Single-pass type IV membrane protein.
• Protein Description: Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor (By similarity)..
• Protein Sequence: MDVPSSWDALRKQARKIEAQLDEQMHSYRRLVSTKALSKSDGNESDLEAGIDLLLRQLQQVNAQMQAWVSSGGSEMVSHTLTRHQEILQDLTQEFYRHRSSLRAKQEHASLLEDFREFDRTRLDLEDGYGSEQALIKEHMGINRNTAQMDGVISQAQATLGTLVFQRSTFGGINSKLSNVASRLPTVNTILAAIKRKKSMDTIILSLVAAVCTFLIFIYWITK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
129	Phosphorylation	RLDLEDGYGSEQALI CCCCCCCCCCHHHHH	29.78	23111157
131	Phosphorylation	DLEDGYGSEQALIKE CCCCCCCCHHHHHHH	20.32	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GOS11_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GOS11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GOS11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ERDL4_ARATH	AT1G19450	physical	22737156
CDPKP_ARATH	CPK25	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.