GOLP3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GOLP3_MOUSE
• UniProt AC: Q9CRA5
• Protein Name: Golgi phosphoprotein 3
• Gene Name: Golph3
• Organism: Mus musculus (Mouse).
• Sequence Length: 298
• Subcellular Localization: Isoform 2: Golgi apparatus.; Golgi apparatus, Golgi stack membrane ; Peripheral membrane protein ; Cytoplasmic side . Golgi apparatus, trans-Golgi network membrane ; Peripheral membrane protein ; Cytoplasmic side . Mitochondrion intermembrane space . Cell
• Protein Description: Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis (By similarity)..
• Protein Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGGGSGEDEAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDKRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTSLTQRSS ------CCCCHHHHH	32.23	23984901
3	Phosphorylation	-----MTSLTQRSSG -----CCCCHHHHHC	28.28	23984901
5	Phosphorylation	---MTSLTQRSSGLV ---CCCCHHHHHCHH	23.00	23984901
8	Phosphorylation	MTSLTQRSSGLVQRR CCCCHHHHHCHHHHH	20.95	23984901
9	Phosphorylation	TSLTQRSSGLVQRRT CCCHHHHHCHHHHHH	38.03	25266776
35	Phosphorylation	AAGGGGGSGEDEAQS HCCCCCCCCHHHHHH	42.14	25521595
42	Phosphorylation	SGEDEAQSRRDEQDD CCHHHHHHHCCCCCC	36.01	25367039
55	Phosphorylation	DDDDKGDSKETRLTL CCCCCCCCHHHHHHH	40.85	20469934

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GOLP3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GOLP3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GOLP3_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of GOLP3_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.