UniProt ID | GOGA7_RAT | |
---|---|---|
UniProt AC | Q6AYQ1 | |
Protein Name | Golgin subfamily A member 7 | |
Gene Name | Golga7 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 137 | |
Subcellular Localization |
Golgi apparatus membrane Lipid-anchor. |
|
Protein Description | May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS (By similarity).. | |
Protein Sequence | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRVDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGVSSGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
69 | S-palmitoylation | GQSYLEGCLACLTAY CCHHHHHHHHHHHHH | 1.27 | - | |
72 | S-palmitoylation | YLEGCLACLTAYTIF HHHHHHHHHHHHHHH | 1.93 | - | |
95 | Ubiquitination | KVLKKVSKYIQEQNE HHHHHHHHHHHHHHC | 49.73 | - | |
103 | Ubiquitination | YIQEQNEKIYAPQGL HHHHHHCCCCCCCCE | 48.87 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GOGA7_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
69 | C | Palmitoylation |
| - |
72 | C | Palmitoylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GOGA7_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GOGA7_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...