dbPTM

GN_EBVG - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GN_EBVG
UniProt AC	P0C6Z4
Protein Name	Envelope glycoprotein N {ECO:0000255\|HAMAP-Rule:MF_04037}
Gene Name	gN {ECO:0000255\|HAMAP-Rule:MF_04037}
Organism	Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4).
Sequence Length	102
Subcellular Localization	Virion membrane Single-pass type I membrane protein . Host membrane Single-pass type I membrane protein . Host Golgi apparatus, host trans-Golgi network . When coexpressed with gM, localizes in the host trans-Golgi network.
Protein Description	Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis..
Protein Sequence	MGKVLRKPFAKAVPLLFLAATWLLTGVLPAGASSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCFNKFVNTLLTD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of GN_EBVG !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GN_EBVG !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GN_EBVG !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GN_EBVG !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GN_EBVG !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GN_EBVG

Related Literatures of Post-Translational Modification