GN_EBVB9 - dbPTM
GN_EBVB9 - PTM Information in dbPTM
Basic Information of Protein
UniProt ID GN_EBVB9
UniProt AC P03196
Protein Name Envelope glycoprotein N {ECO:0000255|HAMAP-Rule:MF_04037}
Gene Name gN {ECO:0000255|HAMAP-Rule:MF_04037}
Organism Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4).
Sequence Length 102
Subcellular Localization Virion membrane
Single-pass type I membrane protein . Host membrane
Single-pass type I membrane protein . Host Golgi apparatus, host trans-Golgi network . When coexpressed with gM, localizes in the host trans-Golgi network.
Protein Description Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis..
Protein Sequence MGKVLRKPFAKAVPLLFLAATWLLTGVLPAGASSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCFNKFVNTLLTD
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of GN_EBVB9 !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of GN_EBVB9 !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of GN_EBVB9 !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of GN_EBVB9 !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of GN_EBVB9 !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of GN_EBVB9

loading...

Related Literatures of Post-Translational Modification

TOP