UniProt ID | GN_EBVB9 | |
---|---|---|
UniProt AC | P03196 | |
Protein Name | Envelope glycoprotein N {ECO:0000255|HAMAP-Rule:MF_04037} | |
Gene Name | gN {ECO:0000255|HAMAP-Rule:MF_04037} | |
Organism | Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4). | |
Sequence Length | 102 | |
Subcellular Localization |
Virion membrane Single-pass type I membrane protein . Host membrane Single-pass type I membrane protein . Host Golgi apparatus, host trans-Golgi network . When coexpressed with gM, localizes in the host trans-Golgi network. |
|
Protein Description | Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.. | |
Protein Sequence | MGKVLRKPFAKAVPLLFLAATWLLTGVLPAGASSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCFNKFVNTLLTD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GN_EBVB9 !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GN_EBVB9 !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GN_EBVB9 !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GN_EBVB9 !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GN_EBVB9 !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...