UniProt ID | GMFB_MOUSE | |
---|---|---|
UniProt AC | Q9CQI3 | |
Protein Name | Glia maturation factor beta | |
Gene Name | Gmfb | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 142 | |
Subcellular Localization | ||
Protein Description | This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.. | |
Protein Sequence | MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSESLVVCD ------CCCCEEEEE | 35.57 | - | |
2 | Phosphorylation | ------MSESLVVCD ------CCCCEEEEE | 35.57 | 29233185 | |
4 | Phosphorylation | ----MSESLVVCDVA ----CCCCEEEEECH | 21.11 | 29233185 | |
53 | Phosphorylation | DEELEGVSPDELKDE CHHHCCCCHHHHHHH | 37.17 | 22324799 | |
74 | Acetylation | RFIVYSYKYQHDDGR CEEEEEEEEECCCCC | 32.28 | 23954790 | |
110 | Ubiquitination | MYAGSKNKLVQTAEL CCCCCCCCEEEEHHH | 54.49 | - | |
119 | Ubiquitination | VQTAELTKVFEIRNT EEEHHHEEEEEECCC | 58.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GMFB_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GMFB_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GMFB_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GMFB_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...