UniProt ID | GLYL3_HUMAN | |
---|---|---|
UniProt AC | Q5SZD4 | |
Protein Name | Glycine N-acyltransferase-like protein 3 | |
Gene Name | GLYATL3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 288 | |
Subcellular Localization | ||
Protein Description | Acyltransferase which transfers the acyl group to the N-terminus of glycine.. | |
Protein Sequence | MLVLNCSTKLLILEKMLKSCFPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQLLEECDVFNWDQVFQIQGLQSELYDVSKAVANSKQLNIKLTSFKAVHFSPVSSLPDTSFLKGPSPRLTYLSVANADLLNRTWSRGGNEQCLRYIANLISCFPSVCVRDEKGNPVSWSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDDNTASISLLKSLHAEFLPCRFHRLILTPATFSGLPHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
111 | Phosphorylation | QGLQSELYDVSKAVA ECHHHHHHHHHHHHH | 15.39 | - | |
114 | Phosphorylation | QSELYDVSKAVANSK HHHHHHHHHHHHCCC | 16.40 | - | |
128 | Phosphorylation | KQLNIKLTSFKAVHF CCCCEEEEEEEEEEE | 27.41 | - | |
139 | Phosphorylation | AVHFSPVSSLPDTSF EEEEECCCCCCCCCC | 29.55 | - | |
145 | Phosphorylation | VSSLPDTSFLKGPSP CCCCCCCCCCCCCCC | 35.64 | 24719451 | |
233 | Phosphorylation | YSRLVALTLARKLQS HHHHHHHHHHHHHHH | 14.50 | 24719451 | |
258 | Phosphorylation | DDNTASISLLKSLHA CCCHHHHHHHHHHCH | 25.75 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLYL3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLYL3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLYL3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GLYL3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...