| UniProt ID | GLRX5_MOUSE | |
|---|---|---|
| UniProt AC | Q80Y14 | |
| Protein Name | Glutaredoxin-related protein 5, mitochondrial | |
| Gene Name | Glrx5 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 152 | |
| Subcellular Localization | Mitochondrion matrix . | |
| Protein Description | Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase (By similarity). Required for normal iron homeostasis (By similarity). Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1 (By similarity). May protect cells against apoptosis due to reactive oxygen species and oxidative stress. [PubMed: 19442627] | |
| Protein Sequence | MSASLSRAAAALLRWGRSAGGGGLPGAGVRAASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALVDEKDQDSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 49 | Acetylation | DALVKKDKVVVFLKG HHHHCCCEEEEEECC | 45.89 | 23864654 | |
| 55 | Succinylation | DKVVVFLKGTPEQPQ CEEEEEECCCCCCCC | 49.64 | - | |
| 55 | Acetylation | DKVVVFLKGTPEQPQ CEEEEEECCCCCCCC | 49.64 | 23806337 | |
| 55 | Succinylation | DKVVVFLKGTPEQPQ CEEEEEECCCCCCCC | 49.64 | 23806337 | |
| 63 | S-nitrosocysteine | GTPEQPQCGFSNAVV CCCCCCCCCCCHHHH | 8.27 | - | |
| 63 | Glutathionylation | GTPEQPQCGFSNAVV CCCCCCCCCCCHHHH | 8.27 | 24333276 | |
| 63 | S-nitrosylation | GTPEQPQCGFSNAVV CCCCCCCCCCCHHHH | 8.27 | 22588120 | |
| 63 | S-palmitoylation | GTPEQPQCGFSNAVV CCCCCCCCCCCHHHH | 8.27 | 28526873 | |
| 147 | Acetylation | RSALVDEKDQDSK-- HHHHCCCCCCCCC-- | 57.11 | 23201123 | |
| 147 | Succinylation | RSALVDEKDQDSK-- HHHHCCCCCCCCC-- | 57.11 | 26388266 | |
| 151 | Phosphorylation | VDEKDQDSK------ CCCCCCCCC------ | 34.33 | 19060867 | |
| 152 | Acetylation | DEKDQDSK------- CCCCCCCC------- | 73.06 | 2373511 | |
| 152 | Succinylation | DEKDQDSK------- CCCCCCCC------- | 73.06 | 26388266 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GLRX5_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...