UniProt ID | GLPC_HUMAN | |
---|---|---|
UniProt AC | P04921 | |
Protein Name | Glycophorin-C | |
Gene Name | GYPC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 128 | |
Subcellular Localization |
Cell membrane Single-pass type III membrane protein. Linked to the membrane via band 4.1. |
|
Protein Description | This protein is a minor sialoglycoprotein in human erythrocyte membranes. The blood group Gerbich antigens and receptors for Plasmodium falciparum merozoites are most likely located within the extracellular domain. Glycophorin-C plays an important role in regulating the stability of red cells.. | |
Protein Sequence | MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | O-linked_Glycosylation | -----MWSTRSPNST -----CCCCCCCCCC | 16.79 | 7106126 | |
4 | O-linked_Glycosylation | ----MWSTRSPNSTA ----CCCCCCCCCCC | 21.47 | 7106126 | |
6 | O-linked_Glycosylation | --MWSTRSPNSTAWP --CCCCCCCCCCCCC | 28.64 | 7106126 | |
6 | Phosphorylation | --MWSTRSPNSTAWP --CCCCCCCCCCCCC | 28.64 | 22210691 | |
8 | N-linked_Glycosylation | MWSTRSPNSTAWPLS CCCCCCCCCCCCCCC | 53.92 | 1991173 | |
8 | N-linked_Glycosylation | MWSTRSPNSTAWPLS CCCCCCCCCCCCCCC | 53.92 | 1991173 | |
9 | O-linked_Glycosylation | WSTRSPNSTAWPLSL CCCCCCCCCCCCCCC | 23.92 | 7106126 | |
10 | O-linked_Glycosylation | STRSPNSTAWPLSLE CCCCCCCCCCCCCCC | 39.11 | 7106126 | |
15 | O-linked_Glycosylation | NSTAWPLSLEPDPGM CCCCCCCCCCCCCCC | 26.97 | 7106126 | |
24 | O-linked_Glycosylation | EPDPGMASASTTMHT CCCCCCCCCCCEEEE | 17.54 | 7106126 | |
26 | O-linked_Glycosylation | DPGMASASTTMHTTT CCCCCCCCCEEEEEE | 23.16 | 7106126 | |
27 | O-linked_Glycosylation | PGMASASTTMHTTTI CCCCCCCCEEEEEEE | 28.05 | 7106126 | |
28 | O-linked_Glycosylation | GMASASTTMHTTTIA CCCCCCCEEEEEEEC | 12.40 | 7106126 | |
28 | Phosphorylation | GMASASTTMHTTTIA CCCCCCCEEEEEEEC | 12.40 | 22210691 | |
31 | O-linked_Glycosylation | SASTTMHTTTIAEPD CCCCEEEEEEECCCC | 18.14 | 7106126 | |
32 | O-linked_Glycosylation | ASTTMHTTTIAEPDP CCCEEEEEEECCCCC | 11.09 | 7106126 | |
33 | O-linked_Glycosylation | STTMHTTTIAEPDPG CCEEEEEEECCCCCC | 21.24 | 7106126 | |
42 | O-linked_Glycosylation | AEPDPGMSGWPDGRM CCCCCCCCCCCCCCC | 43.55 | 22171320 | |
97 | Ubiquitination | TYHTNEAKGTEFAES CEECCCCCCCHHHHH | 61.25 | - | |
99 | Phosphorylation | HTNEAKGTEFAESAD ECCCCCCCHHHHHHH | 27.50 | 28464451 | |
104 | Phosphorylation | KGTEFAESADAALQG CCCHHHHHHHHHHCC | 28.19 | 26657352 | |
121 | Phosphorylation | ALQDAGDSSRKEYFI HHHCCCCCCCCCCCC | 30.99 | 28348404 | |
122 | Phosphorylation | LQDAGDSSRKEYFI- HHCCCCCCCCCCCC- | 52.70 | 28348404 | |
126 | Phosphorylation | GDSSRKEYFI----- CCCCCCCCCC----- | 15.03 | 28450419 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLPC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLPC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLPC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GLPC_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"N-terminal amino acid sequence of sialoglycoprotein D (glycophorin C)from human erythrocyte membranes."; Dahr W., Beyreuther K., Kordowicz M., Krueger J.; Eur. J. Biochem. 125:57-62(1982). Cited for: PRELIMINARY PROTEIN SEQUENCE OF 1-48, AND GLYCOSYLATION AT SER-3;THR-4; SER-6; ASN-8; SER-9; THR-10; SER-15; SER-24; SER-26; THR-27;THR-28; THR-31; THR-32; THR-33 AND SER-42. | |
O-linked Glycosylation | |
Reference | PubMed |
"Human urinary glycoproteomics; attachment site specific analysis ofN-and O-linked glycosylations by CID and ECD."; Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.; Mol. Cell. Proteomics 0:0-0(2011). Cited for: GLYCOSYLATION AT SER-42, STRUCTURE OF CARBOHYDRATES, AND MASSSPECTROMETRY. | |
"N-terminal amino acid sequence of sialoglycoprotein D (glycophorin C)from human erythrocyte membranes."; Dahr W., Beyreuther K., Kordowicz M., Krueger J.; Eur. J. Biochem. 125:57-62(1982). Cited for: PRELIMINARY PROTEIN SEQUENCE OF 1-48, AND GLYCOSYLATION AT SER-3;THR-4; SER-6; ASN-8; SER-9; THR-10; SER-15; SER-24; SER-26; THR-27;THR-28; THR-31; THR-32; THR-33 AND SER-42. | |
"Glycophorins B and C from human erythrocyte membranes. Purificationand sequence analysis."; Blanchard D., Dahr W., Hummel M., Latron F., Beyreuther K.,Cartron J.-P.; J. Biol. Chem. 262:5808-5811(1987). Cited for: PROTEIN SEQUENCE OF 49-88. | |
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-104, AND MASSSPECTROMETRY. |