GLOD5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GLOD5_HUMAN
• UniProt AC: A6NK44
• Protein Name: Glyoxalase domain-containing protein 5
• Gene Name: GLOD5
• Organism: Homo sapiens (Human).
• Sequence Length: 160
• Protein Sequence: MLRHLPSRLPVKMWGRTLEKQSWRDSSQTPPPCLIRRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYISS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
133	Phosphorylation	EEGPVPRTGAKGPIM CCCCCCCCCCCCCEE	37.27	24719451
143	Phosphorylation	KGPIMSIYFRDPDRN CCCEEEEEEECCCCC	15.89	24719451
159	Phosphorylation	IEVSNYISS------ EEEHHCCCC------		24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GLOD5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GLOD5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GLOD5_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of GLOD5_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.