dbPTM

GLNA_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GLNA_SCHPO
UniProt AC	Q09179
Protein Name	Glutamine synthetase
Gene Name	gln1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	359
Subcellular Localization	Cytoplasm.
Protein Description
Protein Sequence	MSQYDVEPLLSKAAILNKYADLPQNGKVMAEYIWIDGFNHLRSKTMTLDAKPSSIDQLRVWNFDGSSTGQAPGNNSDTLLKPVAMYNDPFRRGDNILVLAACYTADGSPNGFNHRDACAKLLEKHADKETWFGIEQEYTMLDYYDRPFGWPKGGFPGPQGPFYCGVGTGRVFARDIVEAHYKACLYAGINISGINAEVMPSQWEYQVGPCAGIEMGDQLWMSRFLLHRIAEDFGVKISFHPKPILGDWNGAGCHTNVSTKDTRAEGGIKAIESYLEKFAKRHKEHIAVYGDDNDLRLTGRHETGSIDKFTYGVADRGASVRIPRSVAMNGCGYFEDRRPASSIDPYLVTGIITETMFEH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSQYDVEPL ------CCCCCHHHH	37.13	24763107
4	Phosphorylation	----MSQYDVEPLLS ----CCCCCHHHHHH	18.04	19547744
43	Phosphorylation	DGFNHLRSKTMTLDA CCCHHCEECEEEECC	38.55	25720772
66	Phosphorylation	RVWNFDGSSTGQAPG EEEECCCCCCCCCCC	26.94	24763107
273	Phosphorylation	GGIKAIESYLEKFAK HHHHHHHHHHHHHHH	28.98	28889911
303	Phosphorylation	RLTGRHETGSIDKFT EECCCCCCCCCCEEE	30.06	28889911
305	Phosphorylation	TGRHETGSIDKFTYG CCCCCCCCCCEEEEE	34.73	28889911
325	Phosphorylation	ASVRIPRSVAMNGCG CEEECCCHHHCCCCC	14.63	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GLNA_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GLNA_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GLNA_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GLNA_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GLNA_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-273; THR-303 ANDSER-305, AND MASS SPECTROMETRY.	18257517 [Abstract]