UniProt ID | GLNA_SCHPO | |
---|---|---|
UniProt AC | Q09179 | |
Protein Name | Glutamine synthetase | |
Gene Name | gln1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 359 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MSQYDVEPLLSKAAILNKYADLPQNGKVMAEYIWIDGFNHLRSKTMTLDAKPSSIDQLRVWNFDGSSTGQAPGNNSDTLLKPVAMYNDPFRRGDNILVLAACYTADGSPNGFNHRDACAKLLEKHADKETWFGIEQEYTMLDYYDRPFGWPKGGFPGPQGPFYCGVGTGRVFARDIVEAHYKACLYAGINISGINAEVMPSQWEYQVGPCAGIEMGDQLWMSRFLLHRIAEDFGVKISFHPKPILGDWNGAGCHTNVSTKDTRAEGGIKAIESYLEKFAKRHKEHIAVYGDDNDLRLTGRHETGSIDKFTYGVADRGASVRIPRSVAMNGCGYFEDRRPASSIDPYLVTGIITETMFEH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSQYDVEPL ------CCCCCHHHH | 37.13 | 24763107 | |
4 | Phosphorylation | ----MSQYDVEPLLS ----CCCCCHHHHHH | 18.04 | 19547744 | |
43 | Phosphorylation | DGFNHLRSKTMTLDA CCCHHCEECEEEECC | 38.55 | 25720772 | |
66 | Phosphorylation | RVWNFDGSSTGQAPG EEEECCCCCCCCCCC | 26.94 | 24763107 | |
273 | Phosphorylation | GGIKAIESYLEKFAK HHHHHHHHHHHHHHH | 28.98 | 28889911 | |
303 | Phosphorylation | RLTGRHETGSIDKFT EECCCCCCCCCCEEE | 30.06 | 28889911 | |
305 | Phosphorylation | TGRHETGSIDKFTYG CCCCCCCCCCEEEEE | 34.73 | 28889911 | |
325 | Phosphorylation | ASVRIPRSVAMNGCG CEEECCCHHHCCCCC | 14.63 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLNA_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLNA_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLNA_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GLNA_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...