| UniProt ID | GLNA_RAT | |
|---|---|---|
| UniProt AC | P09606 | |
| Protein Name | Glutamine synthetase | |
| Gene Name | Glul | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 373 | |
| Subcellular Localization | Cytoplasm. Mitochondrion. | |
| Protein Description | Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity).. | |
| Protein Sequence | MATSASSHLNKGIKQMYMNLPQGEKIQLMYIWVDGTGEGLRCKTRTLDCDPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRRDPNKLVFCEVFKYNRKPAETNLRHSCKRIMDMVSSQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLRCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRIVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPFQYKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MATSASSHL ------CCCCHHHHH | 15.40 | - | |
| 4 | Phosphorylation | ----MATSASSHLNK ----CCCCHHHHHHH | 19.33 | 27097102 | |
| 14 | Acetylation | SHLNKGIKQMYMNLP HHHHHHHHHHHHCCC | 37.37 | 22902405 | |
| 95 | Acetylation | PFRRDPNKLVFCEVF CCCCCCCCEEEEEEE | 51.95 | 22902405 | |
| 103 | Acetylation | LVFCEVFKYNRKPAE EEEEEEECCCCCCCH | 46.95 | 22902405 | |
| 104 | Phosphorylation | VFCEVFKYNRKPAET EEEEEECCCCCCCHH | 14.56 | - | |
| 107 | Acetylation | EVFKYNRKPAETNLR EEECCCCCCCHHHHH | 44.96 | 22902405 | |
| 180 | Phosphorylation | RDIVEAHYRACLYAG CCHHHHHHHHHHHHC | 13.62 | - | |
| 269 | S-nitrosylation | REENGLRCIEEAIDK HHHHCHHHHHHHHHH | 5.73 | 22178444 | |
| 269 | S-nitrosocysteine | REENGLRCIEEAIDK HHHHCHHHHHHHHHH | 5.73 | - | |
| 291 | Acetylation | HIRAYDPKGGLDNAR EEEEECCCCCCCCHH | 63.81 | 22902405 | |
| 291 | Ubiquitination | HIRAYDPKGGLDNAR EEEEECCCCCCCCHH | 63.81 | - | |
| 320 | Phosphorylation | SAGVANRSASIRIPR CHHHCCCCCEEECCC | 26.61 | 23984901 | |
| 322 | Phosphorylation | GVANRSASIRIPRIV HHCCCCCEEECCCCC | 17.41 | 23984901 | |
| 333 | Acetylation | PRIVGQEKKGYFEDR CCCCCCCCCCCCCCC | 43.54 | 22902405 | |
| 333 | Ubiquitination | PRIVGQEKKGYFEDR CCCCCCCCCCCCCCC | 43.54 | - | |
| 334 | Succinylation | RIVGQEKKGYFEDRR CCCCCCCCCCCCCCC | 59.08 | 26843850 | |
| 343 | Phosphorylation | YFEDRRPSANCDPYA CCCCCCCCCCCCHHH | 30.24 | 21738781 | |
| 349 | Phosphorylation | PSANCDPYAVTEAIV CCCCCCHHHHHHHHH | 10.64 | 27097102 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLNA_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLNA_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLNA_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GLNA_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
