GLNA2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GLNA2_DROME
• UniProt AC: P20478
• Protein Name: Glutamine synthetase 2 cytoplasmic
• Gene Name: Gs2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 369
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MSARILEDSPNARINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSARILEDS ------CCCCCCCCC	26.67	27794539
9	Phosphorylation	SARILEDSPNARINK CCCCCCCCCCCCCCH	15.64	19429919
59	Phosphorylation	TLDFIPQSPKELPVW CCCCCCCCCCCCCCE	32.36	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GLNA2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GLNA2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GLNA2_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of GLNA2_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.