UniProt ID | GLEC_DROME | |
---|---|---|
UniProt AC | Q9VD73 | |
Protein Name | Gliolectin {ECO:0000303|PubMed:8631270} | |
Gene Name | glec {ECO:0000312|EMBL:AAF55926.1} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 228 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein . |
|
Protein Description | Has a role in intercellular carbohydrate-mediated cell adhesion.. | |
Protein Sequence | MLCPPMALGPFLAAPVPRPPPSASEKKRICRNLFNNAPGDSNIDQLLAQEQHTQRLYVKERYGYDIQLESNRDADANTDADADTDAHCQVLRGMRYPTSRTISSTDADECNPKAVSQAPRGMALTPAQISASAKLILQKCPESDRKKSNGSADLANCTRHGQKPYARQPQGLKGMYNVRKTVNGISKPNVKNGYNNNNNSSSSNNNSNMNINNKIVDNGTSELADQKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
103 | Phosphorylation | YPTSRTISSTDADEC CCCCCEECCCCHHHC | 26.94 | 21082442 | |
149 | N-linked_Glycosylation | ESDRKKSNGSADLAN HHHHCCCCCCCCHHH | 58.27 | - | |
156 | N-linked_Glycosylation | NGSADLANCTRHGQK CCCCCHHHHHHCCCC | 34.68 | - | |
198 | N-linked_Glycosylation | KNGYNNNNNSSSSNN CCCCCCCCCCCCCCC | 52.46 | - | |
199 | N-linked_Glycosylation | NGYNNNNNSSSSNNN CCCCCCCCCCCCCCC | 45.45 | - | |
205 | N-linked_Glycosylation | NNSSSSNNNSNMNIN CCCCCCCCCCCCCCC | 56.08 | - | |
218 | N-linked_Glycosylation | INNKIVDNGTSELAD CCCCEECCCHHHHHH | 44.76 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLEC_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLEC_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLEC_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...