dbPTM

GLEC_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GLEC_DROME
UniProt AC	Q9VD73
Protein Name	Gliolectin {ECO:0000303\|PubMed:8631270}
Gene Name	glec {ECO:0000312\|EMBL:AAF55926.1}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	228
Subcellular Localization	Membrane Single-pass type II membrane protein .
Protein Description	Has a role in intercellular carbohydrate-mediated cell adhesion..
Protein Sequence	MLCPPMALGPFLAAPVPRPPPSASEKKRICRNLFNNAPGDSNIDQLLAQEQHTQRLYVKERYGYDIQLESNRDADANTDADADTDAHCQVLRGMRYPTSRTISSTDADECNPKAVSQAPRGMALTPAQISASAKLILQKCPESDRKKSNGSADLANCTRHGQKPYARQPQGLKGMYNVRKTVNGISKPNVKNGYNNNNNSSSSNNNSNMNINNKIVDNGTSELADQKQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
103	Phosphorylation	YPTSRTISSTDADEC CCCCCEECCCCHHHC	26.94	21082442
149	N-linked_Glycosylation	ESDRKKSNGSADLAN HHHHCCCCCCCCHHH	58.27	-
156	N-linked_Glycosylation	NGSADLANCTRHGQK CCCCCHHHHHHCCCC	34.68	-
198	N-linked_Glycosylation	KNGYNNNNNSSSSNN CCCCCCCCCCCCCCC	52.46	-
199	N-linked_Glycosylation	NGYNNNNNSSSSNNN CCCCCCCCCCCCCCC	45.45	-
205	N-linked_Glycosylation	NNSSSSNNNSNMNIN CCCCCCCCCCCCCCC	56.08	-
218	N-linked_Glycosylation	INNKIVDNGTSELAD CCCCEECCCHHHHHH	44.76	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GLEC_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GLEC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GLEC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GLEC_DROME

Related Literatures of Post-Translational Modification