GL8D1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GL8D1_MOUSE
• UniProt AC: Q6NSU3
• Protein Name: Glycosyltransferase 8 domain-containing protein 1
• Gene Name: Glt8d1
• Organism: Mus musculus (Mouse).
• Sequence Length: 371
• Subcellular Localization: Membrane ; Single-pass type II membrane protein .
• Protein Sequence: MSFRKVNIIIWVLAVVLFLLVLHHNFLSLSSLLKNDISDSGIVGLQPIDFVASAHQHPVSERQEEIPVVIAASEDRLGGTIAAINSVHQNTRSNVMFYIVTFNSTADHLRSWLNSGSLKSIRYKIVNFDTKLLEGKVKQDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVIIRGAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNVTNQLEKWMKLNVEEGLYSRTLAGSITTPPLLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHFKPWGRTASYADVWEKWYIPDPTGKFSLIRRHMDTSNIK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSFRKVNII ------CCHHHHHHH	33.48	24719451
257	N-linked_Glycosylation	LTEWKRQNVTNQLEK CCHHHHHHHHHHHHH	46.76	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GL8D1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GL8D1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GL8D1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of GL8D1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.