GL120_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GL120_ARATH
• UniProt AC: P92996
• Protein Name: Germin-like protein subfamily 1 member 20
• Gene Name: GLP5A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 222
• Subcellular Localization: Secreted, extracellular space, apoplast.
• Protein Description: May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved..
• Protein Sequence: MRVSQSLVPFAIIALVLSFVNAYDPSPLQDFCVAIDDLKGVFVNGRFCKDPKRVDAKDFFFSGLNVPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDASVVKELQAKFGSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
77	N-linked_Glycosylation	TNNQVGSNVTTVNVD CCCCCCCCCEEEEHH	29.26	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GL120_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GL120_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GL120_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of GL120_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.