UniProt ID | GHT2_SCHPO | |
---|---|---|
UniProt AC | O74969 | |
Protein Name | High-affinity glucose transporter ght2 | |
Gene Name | ght2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 531 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
Protein Description | High-affinity glucose transporter.. | |
Protein Sequence | MGFKRGKNFTLVMLIFVSMAGWMFGADTGSIGGVTSMRDFRERYADRYDPITDQYSLSSARQGLLTGMVNVGSLFGCIISSPIADRFGKRLSIIGFCAVYIIGIIVQVTAVPSWVQIMVAKIWTGIGIGALSVLAPGYQSETAPPSIRGTVVVTYQLFVTGGIFIAACINMGTHKLHKTAQWRVSIGINLLWGIITMIGILFLPESPRYLIQVGKDEEAVRVLSESAELFPDSEEVQNEYHRLKSSIDEEFAGGPCSWASIFGKDIRYRTFLGMFVMSLQQLTGNNYFFYYGFSVMQGAGINSPYLSAMILDAVNFGCTFGGMYVLERFGRRNPLIIGGIWQSICFFIYSAVGSRALYHKNGTSNTRAGAVMIVMACLFIFGFAQTWAPAAYVIVGESYPVRYRSKCAAVATASNWLWNFLISFFTPFIQASIGFKYGYVFASCNLTGAIVIFLFAKETKGLTLEEINELYMSVIKPWESGNFKLNYSEQKKVEKEKSRKGGARGESVEYVERASNTDSSPQYSSHEEDYA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
361 | N-linked_Glycosylation | SRALYHKNGTSNTRA CHHHHCCCCCCCHHH | 45.74 | - | |
507 | Phosphorylation | KGGARGESVEYVERA CCCCCCCCHHHHHHC | 24.07 | 28889911 | |
510 | Phosphorylation | ARGESVEYVERASNT CCCCCHHHHHHCCCC | 12.88 | 21712547 | |
515 | Phosphorylation | VEYVERASNTDSSPQ HHHHHHCCCCCCCCC | 46.62 | 28889911 | |
517 | Phosphorylation | YVERASNTDSSPQYS HHHHCCCCCCCCCCC | 34.46 | 21712547 | |
519 | Phosphorylation | ERASNTDSSPQYSSH HHCCCCCCCCCCCCC | 41.71 | 28889911 | |
520 | Phosphorylation | RASNTDSSPQYSSHE HCCCCCCCCCCCCCC | 20.87 | 28889911 | |
523 | Phosphorylation | NTDSSPQYSSHEEDY CCCCCCCCCCCCCCC | 18.61 | 28889911 | |
524 | Phosphorylation | TDSSPQYSSHEEDYA CCCCCCCCCCCCCCC | 21.70 | 24763107 | |
525 | Phosphorylation | DSSPQYSSHEEDYA- CCCCCCCCCCCCCC- | 29.95 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GHT2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GHT2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GHT2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GHT2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...