dbPTM

GHT2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GHT2_SCHPO
UniProt AC	O74969
Protein Name	High-affinity glucose transporter ght2
Gene Name	ght2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	531
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description	High-affinity glucose transporter..
Protein Sequence	MGFKRGKNFTLVMLIFVSMAGWMFGADTGSIGGVTSMRDFRERYADRYDPITDQYSLSSARQGLLTGMVNVGSLFGCIISSPIADRFGKRLSIIGFCAVYIIGIIVQVTAVPSWVQIMVAKIWTGIGIGALSVLAPGYQSETAPPSIRGTVVVTYQLFVTGGIFIAACINMGTHKLHKTAQWRVSIGINLLWGIITMIGILFLPESPRYLIQVGKDEEAVRVLSESAELFPDSEEVQNEYHRLKSSIDEEFAGGPCSWASIFGKDIRYRTFLGMFVMSLQQLTGNNYFFYYGFSVMQGAGINSPYLSAMILDAVNFGCTFGGMYVLERFGRRNPLIIGGIWQSICFFIYSAVGSRALYHKNGTSNTRAGAVMIVMACLFIFGFAQTWAPAAYVIVGESYPVRYRSKCAAVATASNWLWNFLISFFTPFIQASIGFKYGYVFASCNLTGAIVIFLFAKETKGLTLEEINELYMSVIKPWESGNFKLNYSEQKKVEKEKSRKGGARGESVEYVERASNTDSSPQYSSHEEDYA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
361	N-linked_Glycosylation	SRALYHKNGTSNTRA CHHHHCCCCCCCHHH	45.74	-
507	Phosphorylation	KGGARGESVEYVERA CCCCCCCCHHHHHHC	24.07	28889911
510	Phosphorylation	ARGESVEYVERASNT CCCCCHHHHHHCCCC	12.88	21712547
515	Phosphorylation	VEYVERASNTDSSPQ HHHHHHCCCCCCCCC	46.62	28889911
517	Phosphorylation	YVERASNTDSSPQYS HHHHCCCCCCCCCCC	34.46	21712547
519	Phosphorylation	ERASNTDSSPQYSSH HHCCCCCCCCCCCCC	41.71	28889911
520	Phosphorylation	RASNTDSSPQYSSHE HCCCCCCCCCCCCCC	20.87	28889911
523	Phosphorylation	NTDSSPQYSSHEEDY CCCCCCCCCCCCCCC	18.61	28889911
524	Phosphorylation	TDSSPQYSSHEEDYA CCCCCCCCCCCCCCC	21.70	24763107
525	Phosphorylation	DSSPQYSSHEEDYA- CCCCCCCCCCCCCC-	29.95	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GHT2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GHT2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GHT2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GHT2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GHT2_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-507; SER-515; SER-519;SER-520 AND TYR-523, AND MASS SPECTROMETRY.	18257517 [Abstract]