UniProt ID | GHC1_MOUSE | |
---|---|---|
UniProt AC | Q9D6M3 | |
Protein Name | Mitochondrial glutamate carrier 1 | |
Gene Name | Slc25a22 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 323 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H(+) (By similarity).. | |
Protein Sequence | MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRMYASMSDCLIKTIRSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLPKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQAQLSAQGGAQPSVEAPAPPRPTATQLTRDLLRNHGIAGLYKGLGATLLRDVPFSIVYFPLFANLNQLGRPSSEEKSPFYVSFLAGCVAGSAAAVAVNPCDVVKTRLQSLERGVNEDTYSGFLDCARKIWRHEGPSAFLKGAYCRALVIAPLFGIAQVVYFLGIAESLLGLLQEPQA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Malonylation | ----MADKQISLPAK ----CCCCCCCCCHH | 39.74 | 26320211 | |
52 | S-nitrosocysteine | MYASMSDCLIKTIRS EEHHHHHHHHHHHHH | 3.12 | - | |
52 | S-nitrosylation | MYASMSDCLIKTIRS EEHHHHHHHHHHHHH | 3.12 | 22178444 | |
52 | S-palmitoylation | MYASMSDCLIKTIRS EEHHHHHHHHHHHHH | 3.12 | 28526873 | |
80 | Acetylation | LTLVTPEKAIKLAAN EEEECHHHHHHHHHH | 57.52 | - | |
83 | Acetylation | VTPEKAIKLAANDFF ECHHHHHHHHHHHHH | 36.61 | 2374335 | |
83 | Ubiquitination | VTPEKAIKLAANDFF ECHHHHHHHHHHHHH | 36.61 | 22790023 | |
96 | Acetylation | FFRHQLSKDGQKLTL HHHHCCCCCCCCCCC | 74.58 | 23864654 | |
151 | Phosphorylation | LAAQAQLSAQGGAQP HHHHHHHHHCCCCCC | 13.38 | 29899451 | |
188 | Acetylation | HGIAGLYKGLGATLL CCCHHHHHCCCCHHH | 53.34 | 23201123 | |
218 | Phosphorylation | LNQLGRPSSEEKSPF HHHCCCCCCCCCCCC | 49.36 | 29899451 | |
271 | S-nitrosocysteine | TYSGFLDCARKIWRH CHHHHHHHHHHHHHC | 4.25 | - | |
271 | S-nitrosylation | TYSGFLDCARKIWRH CHHHHHHHHHHHHHC | 4.25 | 22178444 | |
271 | S-palmitoylation | TYSGFLDCARKIWRH CHHHHHHHHHHHHHC | 4.25 | 28526873 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GHC1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GHC1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GHC1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GHC1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...