GG3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GG3_ARATH
• UniProt AC: Q6AWT8
• Protein Name: Guanine nucleotide-binding protein subunit gamma 3
• Gene Name: GG3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 251
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction..
• Protein Sequence: MSAPSGGGEGGGKESAAGGVSSSSLAPSSLPPPRPKSPPEYPDLYGKRREAARVQMLEREIGFLEGEIKFIEGVQPASRCIKEVSDFVVANSDPLIPAQRKSRRSFRFWKWLCGPCLSLVSFCCCCQSKCSCHLRKPKCCNCTSCSCIGSKCCDGSCCSNICCCPRLSCPSCSCFRGCWCSCPDMSCCIPSCFRSCSCTRPSCLNKKKSSCCSCNCKIRWSSCFSCPKVRLCSCCFCNCKNLCSNPCCLAF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MSAPSGGGEGGG ---CCCCCCCCCCCC		22438062
37	Phosphorylation	LPPPRPKSPPEYPDL CCCCCCCCCCCCCCC		30291188
248	Farnesylation	NLCSNPCCLAF---- CCCCCCCEEEC----		-
248	Methylation	NLCSNPCCLAF---- CCCCCCCEEEC----		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GG3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GG3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GG3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of GG3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.