| UniProt ID | GG12C_HUMAN | |
|---|---|---|
| UniProt AC | A1L429 | |
| Protein Name | G antigen 12B/C/D/E | |
| Gene Name | GAGE12B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 117 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MSWRGRSTYYWPRP -CCCCCCCCCCCCCC | 24.48 | 21945579 | |
| 8 | Phosphorylation | MSWRGRSTYYWPRPR CCCCCCCCCCCCCCC | 21.19 | 21945579 | |
| 9 | Phosphorylation | SWRGRSTYYWPRPRR CCCCCCCCCCCCCCC | 12.55 | 21945579 | |
| 10 | Phosphorylation | WRGRSTYYWPRPRRY CCCCCCCCCCCCCCC | 14.71 | 21945579 | |
| 13 | Methylation | RSTYYWPRPRRYVQP CCCCCCCCCCCCCCC | 24.18 | - | |
| 15 | Methylation | TYYWPRPRRYVQPPE CCCCCCCCCCCCCHH | 43.79 | - | |
| 17 | Phosphorylation | YWPRPRRYVQPPEMI CCCCCCCCCCCHHHC | 12.52 | - | |
| 33 | Phosphorylation | PMRPEQFSDEVEPAT CCCHHHHCCCCCCCC | 32.34 | 23917254 | |
| 40 | Phosphorylation | SDEVEPATPEEGEPA CCCCCCCCCCCCCCC | 41.78 | 20068231 | |
| 115 | Phosphorylation | PEEGEKQSQC----- HHHCCCCCCC----- | 44.58 | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GG12C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GG12C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GG12C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GG12C_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...