GEMI7_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GEMI7_MOUSE
• UniProt AC: Q9CWY4
• Protein Name: Gem-associated protein 7
• Gene Name: Gemin7
• Organism: Mus musculus (Mouse).
• Sequence Length: 129
• Subcellular Localization: Nucleus, nucleoplasm. Nucleus, gem. Cytoplasm. Found both in the nucleoplasm and in nuclear bodies called gems (Gemini of Cajal bodies) that are often in proximity to Cajal (coiled) bodies. Also found in the cytoplasm (By similarity)..
• Protein Description: The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus (By similarity)..
• Protein Sequence: MQSPLTIPVPVPVLRLPRGPDGFSRGFASDGRRTILRPEVGEGHIQDPPESQEQRARATLRERYLRSLLAMVGHPVSFTLHEGVHVTAQFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYSFKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MQSPLTIP -------CCCCCEEC	8.86	-
3	Phosphorylation	-----MQSPLTIPVP -----CCCCCEECCC	22.15	26824392
6	Phosphorylation	--MQSPLTIPVPVPV --CCCCCEECCCCCE	26.98	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GEMI7_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GEMI7_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GEMI7_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of GEMI7_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.