UniProt ID | GDIR2_MOUSE | |
---|---|---|
UniProt AC | Q61599 | |
Protein Name | Rho GDP-dissociation inhibitor 2 | |
Gene Name | Arhgdib | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 200 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Regulates reorganization of the actin cytoskeleton mediated by Rho family members.. | |
Protein Sequence | MTEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPNVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDWTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTEKDAQPQ ------CCHHHCCHH | 52.31 | - | |
19 | Phosphorylation | EADDDLDSKLNYKPP HCCCCCHHHCCCCCC | 46.47 | 29514104 | |
20 | Acetylation | ADDDLDSKLNYKPPP CCCCCHHHCCCCCCC | 40.18 | - | |
23 | Phosphorylation | DLDSKLNYKPPPQKS CCHHHCCCCCCCCHH | 35.00 | 25159016 | |
24 | Acetylation | LDSKLNYKPPPQKSL CHHHCCCCCCCCHHH | 50.39 | - | |
30 | Phosphorylation | YKPPPQKSLKELQEM CCCCCCHHHHHHHHC | 39.15 | 27600695 | |
32 | Ubiquitination | PPPQKSLKELQEMDK CCCCHHHHHHHHCCC | 64.57 | 22790023 | |
39 | Ubiquitination | KELQEMDKDDESLTK HHHHHCCCCCHHHHH | 66.81 | - | |
39 | Acetylation | KELQEMDKDDESLTK HHHHHCCCCCHHHHH | 66.81 | - | |
43 | Phosphorylation | EMDKDDESLTKYKKT HCCCCCHHHHHHHHH | 48.62 | 26745281 | |
45 | Phosphorylation | DKDDESLTKYKKTLL CCCCHHHHHHHHHHH | 41.42 | 26745281 | |
46 | Acetylation | KDDESLTKYKKTLLG CCCHHHHHHHHHHHC | 61.44 | - | |
75 | Glutathionylation | VTRLSLVCDSAPGPI EEEEEEEECCCCCCE | 4.08 | 24333276 | |
97 | Phosphorylation | LEALKKDTFVLKEGI HHHHHHCEEEEECCE | 25.23 | 23140645 | |
101 | Acetylation | KKDTFVLKEGIEYRV HHCEEEEECCEEEEE | 48.90 | - | |
123 | Acetylation | KDIVSGLKYVQHTYR HHHHHCCCEEEEHHC | 47.07 | 22826441 | |
128 | Phosphorylation | GLKYVQHTYRTGMRV CCCEEEEHHCCCCCC | 9.52 | 25367039 | |
129 | Phosphorylation | LKYVQHTYRTGMRVD CCEEEEHHCCCCCCC | 12.21 | 25367039 | |
137 | Ubiquitination | RTGMRVDKATFMVGS CCCCCCCEEEEEEEC | 46.60 | 22790023 | |
139 | Phosphorylation | GMRVDKATFMVGSYG CCCCCEEEEEEECCC | 20.29 | 26745281 | |
144 | Phosphorylation | KATFMVGSYGPRPEE EEEEEEECCCCCHHH | 18.59 | 25266776 | |
145 | Phosphorylation | ATFMVGSYGPRPEEY EEEEEECCCCCHHHC | 25.81 | 26745281 | |
152 | Phosphorylation | YGPRPEEYEFLTPVE CCCCHHHCEEEEEHH | 15.43 | 26745281 | |
156 | Phosphorylation | PEEYEFLTPVEEAPK HHHCEEEEEHHHCCC | 30.52 | 27600695 | |
174 | Acetylation | ARGTYHNKSFFTDDD CCCCCCCCCCCCCCC | 35.01 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDIR2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDIR2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDIR2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GDIR2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...