UniProt ID | GDI2_ARATH | |
---|---|---|
UniProt AC | O24653 | |
Protein Name | Guanosine nucleotide diphosphate dissociation inhibitor 2 | |
Gene Name | GDI2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 444 | |
Subcellular Localization | ||
Protein Description | Regulates the GDP/GTP exchange reaction of most RAB proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP.. | |
Protein Sequence | MDEEYEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEHLGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPMEALKSSLMGIFEKRRAGKFFSFVQEYDEKDPKTHDGMDLTRVTTKELIAKYGLDGNTIDFIGHAVALHTNDQHLDQPAFDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEGGKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGRVARAIAIMSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQTELKPGTDLLGPVDEIFFDMYDRYEPVNEPELDNCFISTSYDATTHFETTVADVLNMYTLITGKQLDLSVDLSAASAAEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MDEEYEVIVLGT ---CCCCEEEEEECC | 23328941 | ||
128 | Phosphorylation | TPMEALKSSLMGIFE CHHHHHHHHHHHHHH | 25561503 | ||
129 | Phosphorylation | PMEALKSSLMGIFEK HHHHHHHHHHHHHHH | 25561503 | ||
166 | Phosphorylation | GMDLTRVTTKELIAK CCCCCCCCHHHHHHH | 19880383 | ||
167 | Phosphorylation | MDLTRVTTKELIAKY CCCCCCCHHHHHHHH | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDI2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDI2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDI2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GDI2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...