dbPTM

GCH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GCH1_SCHPO
UniProt AC	O13774
Protein Name	GTP cyclohydrolase 1
Gene Name	SPAC17A5.13
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	235
Subcellular Localization
Protein Description	GTP cyclohydrolase 1 is the first enzyme in the biosynthetic pathway leading to folic acid..
Protein Sequence	MEPGKKDYIDSPLRMQPASLSGASTPTIDLDGLSWPCQGTQRRIDTAEEEKVKKISNAISTILECLGEDPERQGLLGTPERYAKAMLYFTKGYEQNLTEVINEAVFQEDHEEMVIVRDIDVFSLCEHHLVPFIGKIHIGYIPRKRVLGLSKLARIANMFSRRLQVQERLTKQVAQAIQAVLKPQGVAVVMEATHMCMVMRGVEKPGSSTVTSSLTGIFQRSHKTREEFFRLIGKF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MEPGKKDYIDSPLRM CCCCCCCCCCCCCCC	18.59	29996109
11	Phosphorylation	GKKDYIDSPLRMQPA CCCCCCCCCCCCCCC	19.10	28889911
19	Phosphorylation	PLRMQPASLSGASTP CCCCCCCCCCCCCCC	29.74	29996109
21	Phosphorylation	RMQPASLSGASTPTI CCCCCCCCCCCCCEE	29.80	29996109
24	Phosphorylation	PASLSGASTPTIDLD CCCCCCCCCCEECCC	38.14	29996109
25	Phosphorylation	ASLSGASTPTIDLDG CCCCCCCCCEECCCC	24.74	28889911
27	Phosphorylation	LSGASTPTIDLDGLS CCCCCCCEECCCCCC	27.49	29996109
34	Phosphorylation	TIDLDGLSWPCQGTQ EECCCCCCCCCCCCC	34.21	27738172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GCH1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GCH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GCH1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YAY8_SCHPO	SPAC4H3.08	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GCH1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-25, AND MASSSPECTROMETRY.	18257517 [Abstract]