| UniProt ID | GBRL2_MOUSE | |
|---|---|---|
| UniProt AC | P60521 | |
| Protein Name | Gamma-aminobutyric acid receptor-associated protein-like 2 | |
| Gene Name | Gabarapl2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 117 | |
| Subcellular Localization | Golgi apparatus. Cytoplasmic vesicle, autophagosome. | |
| Protein Description | Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 (By similarity). Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.. | |
| Protein Sequence | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | WMFKEDHSLEHRCVE CCCCCCCCCCHHHHH | 48.01 | 25521595 | |
| 15 | Glutathionylation | DHSLEHRCVESAKIR CCCCCHHHHHHHCHH | 4.26 | 24333276 | |
| 24 | Acetylation | ESAKIRAKYPDRVPV HHHCHHHHCCCCCCE | 47.68 | - | |
| 24 | Ubiquitination | ESAKIRAKYPDRVPV HHHCHHHHCCCCCCE | 47.68 | - | |
| 25 | Phosphorylation | SAKIRAKYPDRVPVI HHCHHHHCCCCCCEE | 14.91 | 25195567 | |
| 35 | Acetylation | RVPVIVEKVSGSQIV CCCEEEEECCCCCEE | 30.70 | 129673 | |
| 39 | Phosphorylation | IVEKVSGSQIVDIDK EEEECCCCCEEECCC | 14.82 | - | |
| 74 | Ubiquitination | RIQLPSEKAIFLFVD HCCCCCCCEEEEEEE | 51.63 | - | |
| 116 | Phosphatidylethanolamine amidation | YSGENTFGF------ ECCCCCCCC------ | 25.89 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBRL2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBRL2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBRL2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GBRL2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...