dbPTM

GBG7_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GBG7_RAT
UniProt AC	P43425
Protein Name	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Gene Name	Gng7
Organism	Rattus norvegicus (Rat).
Sequence Length	68
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side .
Protein Description	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum (By similarity)..
Protein Sequence	MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGTNNVAQ ------CCCCCCHHH	55.09	-
60	Ubiquitination	PASENPFKDKKPCII CCCCCCCCCCCCCEE	70.65	-
65	Methylation	PFKDKKPCIIL---- CCCCCCCCEEC----	4.08	-
65	Geranylgeranylation	PFKDKKPCIIL---- CCCCCCCCEEC----	4.08	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GBG7_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GBG7_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GBG7_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GBG7_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GBG7_RAT

Related Literatures of Post-Translational Modification